KEGG   Dolosigranulum pigrum: FNV33_00595Help
Entry
FNV33_00595       CDS       T06088                                 

Definition
(GenBank) methylated-DNA--[protein]-cysteine S-methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
dpm  Dolosigranulum pigrum
Brite
KEGG Orthology (KO) [BR:dpm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dpm03400]
    FNV33_00595
Enzymes [BR:dpm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     FNV33_00595
DNA repair and recombination proteins [BR:dpm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    FNV33_00595
 Prokaryotic type
    FNV33_00595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_binding_1 Methyltransf_1N SWIB
Motif
Other DBs
NCBI-ProteinID: QDO90625
UniProt: A0A516GGH7
Position
complement(117256..117774)
Genome map
AA seq 172 aa AA seqDB search
MRPVFYTTCHLNGSPYSLGATSDGIVFIENTPIDDVTKRHWFDKFFDTNQLYQDDNHKIL
VRCRQQLQQYFDGKLTTFDIPLDLKGTSFQKAVWNSLLSVQYGQSKSYKAIAESIGKPTA
SQAVGAAVGQNPIMIIVPCHRILGATRKLTGFRGGLPMKEQLLQLEHIPYKE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccgttttttataccacttgtcatcttaacggtagcccgtatagcctgggtgct
acttctgacggcattgtttttattgagaatacacccattgacgatgtaaccaaacgtcac
tggtttgacaagttttttgacacaaaccaattataccaagacgacaatcataagatttta
gttcgatgtcgtcaacaattacaacaatattttgatggaaaattgacaacttttgacatt
ccacttgatttgaaggggacatccttccaaaaagcggtctggaacagtcttctatctgtc
caatatggtcaatcaaaaagttataaagcaatcgctgagtccatcggcaagccaactgca
tcacaagcagttggtgctgcggttggccaaaatccaattatgattattgtaccttgccat
cgtattcttggcgctactcgaaaactaactggcttccgcggtggcttacccatgaaagaa
caattacttcagttagagcatatcccctataaagaataa

DBGET integrated database retrieval system