KEGG   Dolosigranulum pigrum: FNV33_01200Help
Entry
FNV33_01200       CDS       T06088                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dpm  Dolosigranulum pigrum
Pathway
dpm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dpm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FNV33_01200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dpm03011]
    FNV33_01200
Ribosome [BR:dpm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FNV33_01200
  Bacteria
    FNV33_01200
  Archaea
    FNV33_01200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF848
Motif
Other DBs
NCBI-ProteinID: QDO90738
UniProt: A0A516GGT8
Position
235868..236224
Genome map
AA seq 118 aa AA seqDB search
MASSRTEAHATARMVRIAPRKVRLVVDQIRGKDAAEAISILRFTNRGAAEAVEKVLKSAI
ANAEHNFDMNIESLVVSEAYANEGPTLKRFRPRAKGAASRINKRTSHITVVVSEKKEG
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggcaagttccagaactgaagctcatgcaacagcgcgaatggttcgcatcgctccgcga
aaggttagactcgtcgttgaccaaattagaggaaaagatgcagcagaagctatttctatc
cttcgatttaccaacagaggtgctgccgaagcggtagagaaagtcttgaaatcagctatt
gcaaatgctgagcataactttgacatgaatattgaaagtttagttgtaagtgaagcctac
gcgaacgaaggaccaactcttaagagattccgtccacgtgcgaaaggtgccgcttcacgt
attaacaagagaacaagccacattacagttgtggtatcagagaagaaggagggttaa

DBGET integrated database retrieval system