KEGG   Dialister pneumosintes: BCB69_01250Help
Entry
BCB69_01250       CDS       T04459                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dpn  Dialister pneumosintes
Brite
KEGG Orthology (KO) [BR:dpn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BCB69_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AOH38728
UniProt: A0A1B3WCP2
Position
241031..242020
Genome map
AA seq 329 aa AA seqDB search
MPDFYLIIILIALALAFDFINGFHDTANAVATCIATRAISPQAAIMMSAICNFFGAMVST
GVAKTIGGDIVTSPSMVDSVVLISALFGAIFWNLLTWKFGLPSSSSHALIGGVCGAVMIS
YGIGALNMSGFLTIFIGLICSPIIAMLGGYILMTLFYMILRNYGKGQVNNISKRIQIISA
ALMSFSHGSNDAQKSMGIITLALLSGGYIGALEVPFWVKFVCALAMSLGTSVGGWSIIRT
VGNKIFKMQPINGLAADLNSAATIFSATLLHLPVSTTHVVTGSIMGVGSAKRFRAVHWSV
AYQMVFAWVMTIPCTAAVSAIVYLIFYHI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatttttatctaataattatattgatagcattagctctagcttttgattttatt
aatggatttcatgatacagctaatgcagtagcaacttgtattgctacacgtgctatttct
ccacaagcagctattatgatgtctgctatttgtaatttctttggagcaatggtttctacc
ggtgtagccaaaactattggtggagatattgttacttcgccatcaatggtagattctgta
gtgcttatatctgctttgtttggagctattttttggaatttgcttacatggaaatttggg
cttccatctagttcttctcatgctctgattggcggagtatgtggtgcagttatgatatca
tatggtattggtgcgctgaatatgagtgggtttttaaccatttttattggattaatatgt
tctcctattatagccatgttgggaggatatatattaatgacacttttttatatgattctt
agaaattatggaaaagggcaagttaataacatatcaaaacgtatccagattatatcagca
gcattaatgtcattttctcatggttccaatgatgctcaaaaatctatgggtataattact
cttgcactattatccggcggttacataggtgcattggaagttcctttttgggtaaaattt
gtttgtgcattggcaatgagtctaggtactagtgtgggtggatggagtattattcgtaca
gtaggtaataagatatttaaaatgcaaccgataaatgggttggcagcagatttaaattct
gcagcaactattttctcggctactttactacatcttcctgtttcaactacgcatgtagtt
accggatctattatgggagttggctctgcaaaaagatttcgtgcagttcattggagtgtc
gcttatcaaatggtgtttgcctgggtaatgactattccttgtacagctgcggtcagtgct
attgtatatcttattttctaccatatttaa

DBGET integrated database retrieval system