KEGG   Dialister pneumosintes: BCB69_01915Help
Entry
BCB69_01915       CDS       T04459                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dpn  Dialister pneumosintes
Pathway
dpn00450  Selenocompound metabolism
dpn00970  Aminoacyl-tRNA biosynthesis
dpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BCB69_01915
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCB69_01915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dpn01007]
    BCB69_01915
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpn03016]
    BCB69_01915
Enzymes [BR:dpn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BCB69_01915
Amino acid related enzymes [BR:dpn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BCB69_01915
Transfer RNA biogenesis [BR:dpn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BCB69_01915
 Prokaryotic type
   Other AARSs
    BCB69_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AOH38841
UniProt: A0A1B3WD12
Position
378781..380718
Genome map
AA seq 645 aa AA seqDB search
MSEQGKFYITTPIYYPSAKLHIGHTYCTTIADSMARFHRLDGDEVFFLTGSDEHGQKIQE
KAEAEGVTPIAYTNKIVEMFKELWKELNITHDDFIRTTEERHIQVVQELFQRSYDKGDIY
LGKYEGWYCVPDETFWPENKLTEDHICPDCGRPLQRVSEEAYFFKMSKYANRWLDFVEAN
PNFIQPESRRNEMIQFVKKGLEDLCVSRTSFSWGVPVPFDTKHVVYVWFDALSNYLTAAG
ILDDKEKFKKFWPADVHLVGKEIVRFHSIIWPIMLMSLGIELPKKVYGHGWLIVDGEKMS
KSRGNVIDPIPLIHEFGSDAIRYYLLNDIQLGQDGNFSRERLINRINSDLSNDLGNLLYR
TLSMVEKYDNGVLYQGDASVDEKVLEAVKNIEKQAIDTLSTFKTNMYNWEINDALRGVWS
FVRSLNKLIDVTEPWVLAKQEDKKSALQSVLYHLAEGLRYVSLLVAPIIPLGAEKIWNQL
GLSAFENATYADLTWGQIPNGTVTKKEAPIYPRIDMEEVKETVEEKVETSIVDTSIEPIK
PDISFDEFCNVDLRVAKVLTAEKVKKSKKLLKITVSLGNEERTVVSGISQHYAPEELIGK
HVIFVANLKPAKLMGIESQGMILAATNDDKLIVPTVDISAGSRVK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaaggaaaattttatattacaacaccgatttattatccgagtgctaaatta
catattggacatacttactgtactactattgcagacagtatggctcgttttcatcggtta
gatggggatgaagttttctttttaacgggttctgatgaacatggacaaaagattcaggaa
aaagcggaagcagaaggggtaactcctattgcatacactaataaaatagtagaaatgttt
aaggaactttggaaagaactgaatattactcatgatgattttattcgtacaacagaagag
cgacacatacaagttgtacaagagttattccaacggtcttatgacaagggggatatctat
ttaggaaaatatgaaggctggtattgtgttcctgatgaaacattttggcctgaaaacaaa
ttgacagaagatcatatttgtccggactgtggacgtccgttgcaacgtgtaagtgaagaa
gcatatttttttaaaatgtctaaatatgcaaatcgttggttggattttgttgaggcaaat
ccgaatttcattcagcccgaaagtcgtcggaatgaaatgattcaatttgtaaaaaaggga
ttggaggacttatgtgtatctcgcacaagtttttcttggggagtaccggttccttttgat
actaaacatgtcgtttatgtttggtttgatgctttatctaactatttgacagcagccgga
atattagatgataaagaaaaatttaaaaaattttggccggcagatgttcatttggtggga
aaagaaattgtacgattccattccattatttggcctatcatgcttatgagtcttggtatt
gagttacctaagaaagtgtatggacatggttggcttatcgttgatggggaaaaaatgtca
aaatcaagagggaatgtcattgatccgattcctttgattcatgaatttggctctgatgct
atacgatattatttgcttaatgatattcaacttggacaagatggaaattttagtagagag
cgtttaatcaatcgcatcaactctgatttatctaatgatttagggaatttgctttaccgt
acactttctatggtagaaaaatatgataatggagttctttatcaaggagatgcttctgta
gacgaaaaagttttggaagcagtaaaaaatatagaaaagcaagcaattgatactttaagt
acttttaaaactaatatgtataattgggaaattaatgatgcattgcgaggcgtttggtct
tttgtgcgttcattaaataaattgattgatgtgacagaaccttgggttttagcaaaacaa
gaggacaagaaatctgcattgcaatccgttttatatcatttggcggaaggtctccgttat
gtatctttgttggtagctcctatcattccactaggagcagaaaagatttggaatcaatta
ggattatctgcatttgaaaatgcaacttacgcagacttaacttgggggcaaattccaaat
gggactgtaactaagaaagaagctcctatttatcctcgtattgatatggaagaagtaaaa
gaaacggtagaagagaaagtggaaacatctattgtagatacaagtattgaacctattaag
ccggacatatcttttgatgaattttgcaatgtagatttacgtgttgccaaggtattaact
gctgaaaaagttaaaaaatctaaaaaattactaaaaataacagtttctttaggtaatgaa
gaaagaactgttgtgagcggaatatctcaacattatgcaccggaagaattgattggaaaa
catgttatttttgtagctaatttaaagccggctaagttaatggggattgaatcacaaggg
atgattcttgcagcaactaatgatgataaattaatagtacctactgtagatatttctgca
ggaagtcgagttaaatga

DBGET integrated database retrieval system