KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10702Help
Entry
Dpse_GA10702      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dpo03110]
    Dpse_GA10702
Enzymes [BR:dpo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Dpse_GA10702
Chaperones and folding catalysts [BR:dpo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    Dpse_GA10702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 4804611
NCBI-ProteinID: XP_001361144
FlyBase: FBgn0070758
UniProt: Q28Z93
Position
3
AA seq 108 aa AA seqDB search
MGVQVVPISPGDGSTFPKNGQKVVVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGW
DEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtacaagttgttccaatttctcccggtgacggcagcacattccccaagaacggc
caaaaagtcgtggtgcactacaccggaaccttggacgatggcaccaagttcgattcgtcg
cgcgaccgcaacaagccctttaagttcaccatcggcaagggcgaagtcatccgcggctgg
gacgagggcgttgctcagttgagcgtgggccagcgcgccaagctcatctgctccccggac
tacgcctacggcagccgtggacacccaggagtcatcccccccaactcgacccttactttc
gacgtcgagttgctcaaggtcgaataa

DBGET integrated database retrieval system