KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10739
Entry
Dpse_GA10739      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K05683  ATP-binding cassette, subfamily G (WHITE), member 5 (sterolin 1)
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Dpse_GA10739
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpo02000]
    Dpse_GA10739
Transporters [BR:dpo02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG5, 8 subgroups
    Dpse_GA10739
SSDB
Motif
Pfam: ABC_tran ABC2_membrane ABC2_membrane_7 AAA_29 DUF3827 AAA_16 AAA_21
Other DBs
NCBI-GeneID: 4801287
NCBI-ProteinID: XP_001358407
FlyBase: FBgn0070795
UniProt: A0A6I8UNS9
Position
2:complement(10034189..10037174)
AA seq 604 aa
MKMIGSDYVLEAHNIFHTTEVDGGGCFNGAGNSALVLKGVNLTVHSGEVMAILGSKGSGK
RALLDVISRRADGATRGQVLLNGSPLSKALFQQRCGYVTQSCTFVPGLTVAQTLHYTPTI
LSGYLKSSKVRQVLADLALSQVAHKRVEYLNISEARRLAIGIQLVRDPVMLLLDEPTHGL
DPLSAYLLISILSNTAKKTGCGILLSLEKPRSDVFPFLDRALFLCLGGVVYSGGTRAMLE
YFHGIGFPCPQLENPLMYYLCLSTVDRRSRDRFLESSQQIEALVERFSRETPISDAPLNN
MGSGKVPLAYGKPGELKVWVMLYLKLLASTFSCGLVGMKTLFLRLLLLPIALSILWAFYT
NVGDDAHGFFTRNGMILNILGLSYGCGILTTISLFPVWRKKLSQDTPEGLYSGTTLLIAY
NAVSIPFSAVSAVITSCVVYPLLLDLKYNNGIVFAYLFVALWSSFVLAEQLTIAFLLVVK
VPFNAAIAVTYALVISIALASGTVRSFKGLQPWLQDNTKGTHTRYASSLLHSIAFQTRKL
NCTPTASVICPKPTDFMHERLGLPHPDETIDVAASCAFAVGLAAFNMLVYLFPMPRCVRQ
KFKD
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaaaatgattggaagcgactacgtactggaagcgcacaacatattccacaccaccgag
gtggatggcggcggctgcttcaatggagccggcaattcggccctggtgctcaaaggcgtc
aacctcaccgtccacagtggcgaagtgatggccatactgggctcaaagggcagtggaaag
agggccttgttggatgtcatttcgaggcgtgccgatggagccacccgcggtcaggtgcta
ctgaatggatctccgttgtccaaggccttgttccagcagcgatgcggctatgtgacacaa
tcctgcacctttgtgcccggcctgacggtggcccagaccctccactacacgccaacgatt
ttgagtggctatctaaagagttccaaggtgcgacaagtactggctgatttggccctatcg
caggtggcccacaagcgtgtggagtatctgaacatcagtgaggcgagacgcctggccatt
ggcatacaactggtcagagatccagtaatgctattgctggatgagcctacgcatggactc
gatcccctgagcgcctatctgctgatatccattctatccaacacggccaagaaaactgga
tgtgggattttactttcgctagagaagccacgctccgatgtgttcccattcttggatcgt
gctctgtttctgtgcctgggcggtgttgtctactctggtggcactcgcgccatgctggag
tacttccatggcattggttttccctgcccccagctggagaatcccctcatgtattatctc
tgcctgtccactgtggatcgtcgcagccgtgataggttcttggagtccagccagcaaatc
gaggcgcttgtggaacgattctccagagaaactcctatctctgatgcgccattgaataac
atgggatcgggcaaggttccactggcctacggaaaaccgggagagcttaaagtctgggtt
atgctgtacttgaaactgcttgcatccaccttctcctgcggtctggttggcatgaagacg
cttttcctccgactgctgctgcttcccatagccttgagcattctttgggctttctataca
aatgtgggggacgatgcccatggcttcttcaccagaaatggcatgattctgaacatattg
ggattgtcctatggctgcggtattctgaccaccatatctctatttccagtttggcgaaag
aagctctcacaggacaccccagagggcctgtactccggcaccactctcctaattgcgtac
aatgccgtatccattcctttctctgctgtatccgcggtcataaccagctgtgtggtgtat
ccattgctgctggatttgaagtacaacaacggcatagtatttgcctacctttttgtggca
ctttggtccagttttgtgctcgccgaacagctcacaattgcctttctcctggtggtcaag
gttcccttcaatgcagccatcgcggtgacctatgcgctggtcatcagcattgccctggct
agtggtacagtgcgatccttcaaggggctacagccctggctgcaggacaacaccaagggc
acacatacgcgctacgcatcttccctgctccacagcatcgcctttcaaacgcgaaagttg
aattgtacgcccactgcctccgtaatttgccccaagccaacggactttatgcacgagcgt
ctgggcttgccacatccagatgaaaccattgatgtggctgcatcttgtgcgtttgctgtg
ggcctggctgcgtttaacatgctcgtgtatttgttccccatgccgcgctgtgtgcgacaa
aagtttaaggactga

DBGET integrated database retrieval system