KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10843
Entry
Dpse_GA10843      CDS       T01032                                 

Name
(RefSeq) uncharacterized protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Peptidase_S9 Say1_Mug180 Abhydrolase_2
Other DBs
NCBI-GeneID: 5384073
NCBI-ProteinID: XP_001359768
FlyBase: FBgn0070899
UniProt: A0A6I8US22
Position
2:complement(26749672..26755306)
AA seq 582 aa
MSFDIAVADQMRIALNYVKFKTNQQRLRSNDKVIADTLYGKVKGVKWQSIYGNNYYSFEG
IPFAKPPVGELRFKAPVEPDHWTEVKRCTRVRSKPCQVNIVMKLVQGSEDCLYLNVYTRE
LHPNKPVPVLVWIYGGGFQMGEASRDLYSPDYIMMEHVVLVVISYRLGALGFLSLDDKEL
DVPGNAGLKDQVMALRWVKRNCQFFGGDPENITVFGESAGGASTHYMMLTEQTRNLFHKT
VIMSGAALAPWAQTPTHINWTYRLAQATGYSGELNDRQVFAHLKKCKASSLLKVADDIIT
MEERHQRLTMFCFGPTIEPYETDHCVIPKSPLEMMRNCWGNSIPMVIGGNSFEGLLMFPE
VNKWPELLCQLGDCEHLAPRDAHLDKEQQRAFGKQLREAYFGDRKPSRETILEYSDLFSY
KYFWHGIQRTLLSRAHYAPEAPTYLYRFDFDSKHFNIMRIITCGRKVRGTCHADDLSYLF
YNAAAKKLKRRTAEFKTIKRLVSMVVQFAISGDPNIPLVTHDEKHQPQGTGTGTPTSTWL
PISREDAVFKCLNISHDVQVIDLPEAEKLLLWDSCYDRRLLY
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtcattcgatatagccgtggccgatcagatgcgcattgccctgaactatgtgaagttc
aagacgaaccaacagcgccttcgcagcaatgacaaggtgatagccgacacgctctatggc
aaggtgaagggcgtcaagtggcagtcgatttatggaaacaattactacagcttcgaggga
ataccgtttgccaagccccccgtgggggagctgcgattcaaggcacccgtggagcctgac
cattggacggaggtgaagcgatgcacgcgggtacgctccaagccgtgtcaggtgaacatt
gtgatgaagttggtccaaggaagcgaggattgtctgtacctaaatgtgtacaccagagag
ttgcatccaaataaacctgtgcctgtgctcgtttggatctatggcgggggctttcaaatg
ggtgaagcctccagggatctgtacagtcccgactacatcatgatggaacatgtggtcctg
gttgtcatatcctatcgccttggagccctgggatttctcagtctcgacgataaagagctg
gatgtgcccggcaatgcgggcctcaaggaccaagtgatggccctgcgatgggtcaagcgg
aattgtcagttctttggcggtgatccagagaatatcacagtctttggtgagagtgcaggt
ggagcgtccacccactacatgatgctgacggaacagacccgcaatctcttccacaagact
gtgatcatgtcgggtgctgcactggcaccgtgggcccagaccccaacgcatatcaattgg
acatatcgtttggcccaggccacgggctattcgggagagctaaacgatcgccaggtgttt
gctcatctaaagaaatgcaaggccagcagcctgctgaaggtggccgacgatatcattacc
atggaggagcgtcatcagcgcctgaccatgttttgctttggccctaccattgaaccctac
gaaacagatcactgtgtgatacccaagtcgccgctggagatgatgcgcaactgctggggc
aacagcatacccatggtgattggcggcaactcctttgagggtctgctgatgttccccgag
gtgaacaagtggccggagttgctgtgccagctgggagattgcgagcatttggctcccagg
gatgcgcacttggacaaggagcagcagcgggccttcggcaagcagctgagggaagcctat
ttcggcgataggaagcccagtcgtgagactattctggagtacagcgatctcttttcgtac
aaatatttctggcatggcatccaaagaacattgctatcgcgtgcccactacgctccagag
gcgcccacgtatctgtatcgttttgactttgactcgaagcacttcaacatcatgaggatt
atcacctgtggccgcaaggtgcgaggcacatgtcatgccgatgatttgtcgtatttgttc
tacaatgcggcagcaaagaaactaaagcgccgcacggccgaattcaagacgataaaacgt
ctggtgtccatggtggtgcagtttgccatatccggggatcccaatataccgctggtcacg
cacgacgagaagcatcagccacagggcacaggaacgggcacacccacatccacctggttg
cccatttcacgtgaggatgcggtgttcaagtgcctgaatatctcgcatgatgtgcaagtg
attgatttgccagaggccgaaaagttgctgctctgggatagctgctatgacagacgactc
ctgtactga

DBGET integrated database retrieval system