KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA10957Help
Entry
Dpse_GA10957      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpo04131]
    Dpse_GA10957
Membrane trafficking [BR:dpo04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    Dpse_GA10957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N NUC130_3NT
Motif
Other DBs
NCBI-GeneID: 4817744
NCBI-ProteinID: XP_001357093
FlyBase: FBgn0071013
UniProt: Q29NQ9
Position
4
AA seq 2067 aa AA seqDB search
MSNAQRSFVQKVSKQPAADVRKNVCNYHIQSKSADTSLCSSALSPTDPLDYEEFLVQHMN
IVNRDPLKLILDFPQGDVTVKTIPRKIRTIDHITPNEEITDLPQHVQECVNCYTRPWKVV
EYAQRHYSSSCYIREHIDRGTISPSAYQQEFEIDKDFASFDETFTYKSESCTPSSRQSIA
SLASVSSCTDTLTPRGSWASFDLRRSVNDPLIPNLLNNVPPEQIDQTNEVRRQQDRQVAL
FSLYPESEAEEERIERRLLAEIPMEHMGHRIQVKCLQLRLELEVEPIFASMALYDAKERQ
KLSENFYFDMNSDGLKRMLSSHVQCADISTQSHSAIFEVSYPSNDLFLVIRLEKVLQGDI
NNSVEPYLKEDKDKYREKVKSNAADYCERLGKYRMPFAWTGIYLTNVFNGDSFEHKDVGG
GERDSAGSGNVCGGLGTAPSSNSLDRKSSTSSFDQLRRKANDMSGTLTRRGSLERKEKRR
SWSPDDFANVVENFRPITISVPSFFKQEADKMKDEDLYKILPELKRPSSVMKKYKCIPGS
IKLEISPCVEEVKNSLTPELAKINPQSGENIRPIKEILEFPQSAIYNPHYSYRNLLFVSP
KELNFSSRAGSARNIAVRVQLMAGETSKDAVNAIFGKSSCPKFSSEAFTAVNYHNKCPSF
YDEIKIALPASIKQHHHLLFTIYHVSCQKKPQDLQPSVETPIGYTWLPLLEDGKLKVGEF
NLPVMVETPPENYSFIPPNVHLPGIKWLDNHRAVFAINVEAVTAIHTLDSFLDRFFLLCE
YVDTRNIPSHIGEGNMEAELKKCLLDIEHANREPLVRHLPLVLDKLIELLVTTHKIGGQT
MSLGSTVFEVLCLVSSLLSILSDDLIVDQYGRQSLFSTYVQFQCKIPHPLLSKQRFTCRR
SNTEDLQLSNSYSLYDNVSTSGRSLDRKDPAINMLHSIVGRDVQERLLHEELALHWVVAS
GKAAELAMANSWFLFELIVKSMIEHLHNSNTLNAPRKNRFPHQYNDDLSTLVHLVTTKVV
GYHSNEPKLAQSLNASLSFFIFDVLSIMDRGFVFGLIKTYTKVLISKNASIPDLMNYKID
FLRIVCSHEHFVALNLPFGTSYTMISAPCSPTPSTTSSNSQTSCGSLERAVQADLSQEFL
QQHFLVGLVLSDLASVMKVPNPQLHGKAIRCIRNLMTSHDLDTRYSETEARARVASLYIP
LLFIVMDSIPQLHQHGIDHDRLHQIGQLEDYQGPQQTIAAATISPEVAYAISGSRPYYMS
EQVKNKSPLSSENTRHLLVCFLWVLKNLERNILYRWLLGLTPHRVHQMLQVVNVCLKTFE
YTGQKYIPTLKRTNTQSFRKNASTDVKEKLEECIRGTNSARYDLINRRKDRNSTEKFRWR
KDQMPYRSPYTDSVGKNEHDLELSHFIEGSLATEITLVLLDTLEILVHVAANIHHNLLGT
LLKVLLHALSRNQSTLALQNLFASQRALIFKFPNLLFDEETDICADLCLILLKHCGSLLP
GIRSQAAASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSTVFSEQSLRRALKTVLVY
AESDSDLQDTSFPEQVQDLLFNLHMILSDTVKMKEYQEDPEMLLDLMNRIAKGYQNNPDL
RLTWLENMAKKHRERANHTEAAMCYVHAAALVSEYLSMLESQTHLPVGAVSFQRISPNTL
MESAVSDDVLSPGEDGICLGNHFTETGLKALLEEASNSFQVAGMYEAMNEVYKILIPICE
ANRDFLKLGKVHGKLQEAFNRISQLQGKRVFGTYFRVGFYGSKFGDLDQQEFIYKEPTLT
KLPEIFSRLQNFYTERFGPDSVHIIKDSNTVDVNSLDAEKAYIQITYVEPYFETYEMRHR
ETYFERNFNIKRFIYATPFTKSGKAHGELHEQCKRKTILTTANHFPYVKTRIMVISRQQI
VLDPIEVAIEDIQKKTVELAAATNQEPADPKILQMVLQGCIGTTVNQGPMEMASVFLLNL
SDGTTVPTKQQNKLRLCFREFSKRCADALKKNRNLILSDQKDYQRELERNNDRFIERLTP
LITLTAIQNLGVVKANAYYNKSTPLKW
NT seq 6204 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgcacagcgctcgtttgtgcaaaaagtatcaaaacagcctgctgcagatgtt
cgaaaaaatgtttgtaattaccacatccaatcaaagtcagcagacacctctctgtgttca
tccgcactatctcccacagatccgcttgactatgaggagttcctcgtacaacatatgaac
atcgtcaaccgcgatccattgaagcttatcttggacttcccccagggcgatgtaactgtt
aaaaccattccacgcaaaatccgaacgattgatcacattacaccaaatgaagaaataact
gatttgccgcagcacgtgcaggagtgtgtgaactgctatacccgtccatggaaggtggta
gaatatgctcaaaggcactactcaagctcgtgttacatacgtgaacacattgatcggggc
acaattagtccctccgcataccaacaagagttcgagatagacaaagactttgcatctttt
gatgaaacattcacgtacaaaagcgaaagttgcacacccagctccaggcaatcgatagct
agcctggcttcagttagctcatgcacggacactttgacacctcgcggttcgtgggcaagt
tttgatttgcgccgttctgttaatgatcctctaataccaaacttgcttaataatgtaccg
cccgaacaaattgatcaaaccaatgaagtgcgacgccagcaagatcgacaggttgctctt
ttttccctgtacccggaatctgaagcagaggaggagcgtatcgaacgcagactgcttgct
gagattcctatggaacatatgggtcatcgcattcaggtgaagtgtctgcagcttcgactc
gaactcgaggtagaaccaatatttgcttctatggctttatatgatgccaaggaacgtcaa
aaactatcagagaacttttactttgacatgaactcagacggtctcaaacgaatgttgtcc
agccacgtccaatgcgccgacataagcacccaaagtcactcggcaatatttgaagtttct
tacccgagcaatgatttgtttttggttattcgtctggagaaagtgctacagggggatatt
aacaattccgttgaaccttacttaaaggaagacaaagacaagtaccgtgaaaaggtaaaa
tcaaatgctgcagactattgtgagcgcttgggaaaatatcgaatgccatttgcttggact
ggcatttatttaacaaacgtcttcaatggtgacagctttgagcacaaggatgttggtgga
ggagagcgtgattcggctggcagcggtaacgtttgtggcggcttaggtacggctccaagc
tccaacagcttagatcgcaagtcttccacgagtagctttgatcaactaagacgcaaagca
aatgatatgagtggaacgcttactcggcgtggttctctagagcgaaaggagaaacggcgt
tcatggtcaccagatgatttcgcgaatgttgttgagaactttcggcctattacgatatcg
gttcccagcttctttaagcaagaggcagataaaatgaaggatgaagatttatataaaata
ttaccggagctaaagcggccgagctcagttatgaaaaaatacaaatgcattccaggctcg
attaaactggaaatatctccatgtgttgaggaagtcaaaaactcgctaacaccagagttg
gctaaaattaacccacaaagtggtgaaaatattcgaccaatcaaagaaattctagaattc
ccgcaatcagctatatacaatccacactatagctatcggaacttacttttcgtgtcgcca
aaggagctcaatttctcttcacgcgccggctcagcacgtaacattgccgttcgtgttcaa
ctaatggctggagagacctcgaaagatgcagttaatgctatttttggcaaatcatcttgc
cccaaattttcttctgaagcatttacggctgtaaattatcataataaatgtccgtcattc
tatgatgagattaagatagccttacctgcgtccataaaacagcatcaccatctactattc
accatataccacgtgtcctgccaaaaaaaaccacaggatttgcagccttctgtagaaacc
cccatcggatacacttggctgcccctattagaggatggcaaactgaaagttggtgaattt
aatcttcctgttatggtggagactccgccagaaaattattcttttatacctccaaatgta
cacctgccaggaattaagtggcttgacaatcatcgagccgtgttcgccattaacgtagag
gcagtgactgcaatacatactttggattcgttcctcgatcgttttttcttgttgtgtgaa
tatgtggacacccgtaatataccttcacatatcggcgaggggaatatggaggctgagttg
aaaaagtgtttgttggatatcgagcatgcaaaccgtgagccattagtaagacacttaccc
ctagtgttggacaagcttattgaattgttagttacgacccacaaaattggtggacagact
atgtccctgggatctacagtcttcgaagttctttgcttagtatcttcacttttgtcaata
ttaagcgacgatttaatagttgatcaatatggacggcaaagtttgttttcaacttatgtg
caatttcaatgtaaaataccacacccactcctcagcaagcagcggtttacctgcagacga
agcaacaccgaagacttgcaattaagcaattcatacagtttgtatgacaatgtttcaacc
agtggtcggagtttggatcgcaaggatcctgctattaatatgctacactctattgttggt
cgtgatgttcaagaacggctgctgcacgaagaactggcccttcactgggtcgttgccagt
gggaaagcagcagagctagccatggcgaattcatggtttttattcgagcttattgtcaag
tctatgatagagcatttgcacaattcaaacactttaaacgcgccacgtaaaaatcgattt
ccacatcaatataatgacgatctgtcaacactagttcatttagttaccacaaaagttgtg
ggatatcatagtaatgaacccaagttggcacaatccttgaatgctagtctaagctttttc
atatttgatgtattaagcatcatggaccgcggatttgtttttggactgataaaaacgtat
actaaagtgctaatttcgaagaacgcgtctattccagacttaatgaattataagatagat
tttctgagaattgtatgcagccatgagcactttgtagcactgaatttgccattcgggact
tcatatacaatgatttcagcaccctgcagcccaaccccaagtacgacgtcgagcaacagt
caaacatcatgtggttcgcttgagcgtgcagtgcaagccgatcttagtcaggagttcctt
caacaacactttcttgtcggactggttttaagcgatttggcttcagtaatgaaggtaccc
aatccccaattgcacggaaaagcgatacgctgcattcgtaacctgatgacttcacatgat
ttagatacacggtatagcgaaacggaagcacgcgcccgtgtggcgtctttatacataccg
cttctattcatagtgatggacagcattccccaattgcatcagcatggcattgatcatgac
cgcttacatcagatcgggcagcttgaagattatcaaggaccgcagcaaactattgcagca
gcgactataagtccagaagtggcgtacgcaatatctggaagtcgcccctactacatgagt
gaacaagtaaaaaacaagtccccattaagctctgaaaacacgcgccacttgttagtatgc
tttctttgggtacttaagaatttggagcgtaacatattataccgctggttgctaggttta
actcctcatagggtgcaccaaatgctacaagtggtaaatgtctgcctaaaaacttttgag
tatacgggacaaaaatacattcccaccctaaagcggaccaatacacaaagtttcagaaag
aacgcatctactgacgtaaaggaaaaattggaagaatgtataagaggtacgaactccgcc
cgctatgatctaattaatcgtcgaaaagatcgcaattcgaccgagaaattccggtggcga
aaggatcagatgccctaccgttcgccctacaccgatagtgttggcaaaaatgagcacgat
ctggagctgagccactttatcgaagggtcattggcaactgaaattacgcttgttctactc
gacactctagaaatattagtgcacgtagctgccaacattcaccataacttactcggtact
ctgcttaaagtgctgcttcacgcactctcccgtaatcagtcaacgctggcgctgcaaaat
ttgtttgcctctcagcgtgcgctaatttttaaattccccaacctattgtttgacgaggaa
acggacatctgtgcggatttgtgtttgatattactaaagcattgtggatcgcttttacca
ggaatacgctcacaggctgcagcctcgttatatttactaatgagacaaaactttgaaatt
ggaaataactttgctcgcgtcaagatgcaagtaacaatgtcgttaagttcattagttggt
accagcactgtatttagcgagcaatcacttcgtcgagccctgaaaacggtcttagtttat
gccgagtcagactccgatctacaggatacatcatttcctgagcaggtgcaagatttgctt
ttcaatctgcatatgattctatcggatacagtgaaaatgaaggaatatcaggaagaccca
gaaatgttgctggatctcatgaatcgtatagccaaaggataccaaaacaatccagacctg
cggttgacctggttagaaaacatggccaaaaagcaccgtgaacgtgctaatcatacagag
gcagccatgtgctacgttcacgcagctgccttagtctcagaatatctcagcatgttggag
tctcagacccatttacctgttggagcagtcagctttcaacgcatttccccaaatacgctc
atggagtcggccgtatcagatgatgtgcttagccctggcgaggatggtatttgcctggga
aaccattttactgagactggcctaaaggcgctgctcgaagaggcttccaactcatttcaa
gtcgctggaatgtatgaagcaatgaacgaagtatataagattttaatacccatctgcgaa
gccaacagagactttcttaagctaggtaaagttcacggaaaattgcaggaagcatttaat
cgaatctcccagctacagggcaagcgagtgtttggtacatattttcgtgtgggtttctat
ggaagcaaatttggagatttagatcaacaagaatttatttacaaggagccgacattgaca
aagttaccagagatattcagccgactacagaacttttatacggaacgatttggcccagat
tctgtacatatcataaaggactcgaatacagttgatgtgaactcattagatgccgaaaag
gcatatattcaaatcacatacgtagaaccttattttgaaacatatgaaatgcgtcatcgc
gaaacctactttgagaggaactttaacattaaacgttttatatatgccacaccatttaca
aaaagtggtaaggcccatggagagttgcatgaacaatgcaagagaaagacaattttaaca
acagccaatcactttccatatgtaaaaacaagaataatggtaattagtcggcagcaaata
gtcttggatccaattgaagtagcaattgaggatattcaaaagaaaacagttgaattggcg
gctgctacaaatcaggagcctgctgatcctaaaatattgcaaatggtcttgcaaggatgt
attggaacgaccgttaaccaaggacctatggaaatggctagcgtttttctcttaaattta
tcagatggcacaaccgtaccaacgaaacagcaaaacaaattacggctgtgttttcgcgag
ttttcaaagcgatgtgctgatgctttgaaaaagaatcgtaacctaatactttcagatcaa
aaggattaccaacgtgaattggaacgtaacaacgatcgttttatagaacgcttaacacct
ttaataactcttaccgcaattcaaaatcttggcgttgttaaggcaaacgcatactacaac
aaaagcactccattgaaatggtaa

DBGET integrated database retrieval system