KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA11601Help
Entry
Dpse_GA11601      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00900  Terpenoid backbone biosynthesis
dpo01100  Metabolic pathways
Module
dpo_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dpse_GA11601
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dpo01006]
    Dpse_GA11601
Enzymes [BR:dpo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Dpse_GA11601
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Dpse_GA11601
Prenyltransferases [BR:dpo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Dpse_GA11601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt AsiA
Motif
Other DBs
NCBI-GeneID: 4805096
NCBI-ProteinID: XP_001361556
FlyBase: FBgn0071652
Position
3
AA seq 419 aa AA seqDB search
MFKLARRILPQQRIFPNPLRLHRLISTSDEVNAEPIIKSMETIGGLSTELVNEQKLKKTS
RTLSTLQNHSVPIAARVTVSKDESRDFMAVFPDLVRDITTVTKTYNCNDAAKWFAKVLQY
NVPRGKKNRGILTVLTYKNLVPAEDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTT
RRGQPCWHKVENVGLTAINDALMIENAMYAILKMHFSHLDCYVALMELFHEITYITTCGQ
SLDQLNSHRSVSEFTMENYKAIVDNKTAYYSFYLPFAVALHLAGYKDAEAFRQSKTILLE
MGHFFQVQDDFLDCFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANAEQKKIMVDCYGNND
PVKVERVKELYKEIGLPTTFATFEEESYNMIKTHIQQTSRGVPHQTFLQILNKIYQRDS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaactagctcgtcggattcttccccagcagcggatatttccaaatccgctgcgt
cttcaccgactaatctccaccagcgacgaagtcaacgcggagcctattatcaaatccatg
gaaacgattggcggcctgtccacggaacttgttaacgagcagaagctgaagaagaccagc
agaacattatcaacgcttcaaaatcactctgttccaattgcggcccgcgtcacagtgtca
aaagatgaaagtcgcgactttatggctgtgttccccgatcttgtgcgtgacatcactacc
gtgacgaagacctataattgcaatgatgccgctaagtggtttgccaaggtgctgcaatac
aatgtaccgcggggtaaaaagaatcgcggcatactcacagtgctcacctacaagaatctg
gtgcccgccgaagatctgaccccagaaaacataaagctggcccagtacctgggatggtgt
gtggaaatgcttcagagcttcttcataatctctgacgacgtgatggacaacagcacaaca
cgacgcggacagccgtgctggcacaaggttgagaacgttggcttgacggccatcaatgat
gctctaatgattgagaatgccatgtatgccatattgaagatgcatttcagccacctagac
tgctatgtggcgctcatggagcttttccatgagattacctacataacaacttgtggccag
tccctagatcagctcaactcgcatcgaagtgtttccgagttcactatggagaactacaaa
gcaattgtggacaacaaaactgcctactattcattctatctgccgtttgctgttgcttta
cacttggctggatataaggacgccgaagctttccgacaatcaaagaccattctcctggaa
atgggtcactttttccaagtgcaagacgatttccttgactgcttcgggaatccggaggtg
actggcaaaatcggcaccgacatacaggacaacaaatgctcctggctagccgtggtggcc
atgcagcgagccaatgccgaacaaaagaaaatcatggttgattgctatggaaacaatgat
ccagtcaaggtggagcgtgttaaggagctttacaaggaaatcggcttaccaactactttt
gccacattcgaagaggagtcgtacaacatgattaaaacgcacatacagcaaacatcgcgc
ggtgttccccaccaaactttcctgcaaatcctcaacaaaatctaccagcgagactcctaa

DBGET integrated database retrieval system