KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA12461
Entry
Dpse_GA12461      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K10743  ribonuclease H2 subunit A [EC:3.1.26.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo03030  DNA replication
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dpse_GA12461
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dpo03032]
    Dpse_GA12461
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     Dpse_GA12461
DNA replication proteins [BR:dpo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    Dpse_GA12461
SSDB
Motif
Pfam: RNase_HII
Other DBs
NCBI-GeneID: 4816796
NCBI-ProteinID: XP_001356439
FlyBase: FBgn0072507
UniProt: Q29N40 A0A6I8UJD4
Position
4
AA seq 358 aa
MNLSFTTLDRKKAKKARRMEDIKIKEENKTNSEGDPSDDEDKKDIGKITSLKSLGPFIAS
RENSQNTVYLSDVPAVCKDKPCMLGVDEAGRGPVLGPMVYGISYCPLESKQALIDLGCAD
SKQLTEEKRDVIFNEMNTLEYANSCVGWAVEIISPNVISTSMYRRAKCSLNEVSMESAMG
LIQQAIDAGVNIAEVYVDTVGPPEKYQEKLLRRFPNFKITVAKKADSTYPIVSAASICAK
VTRDHALKVWRFPEGLVIKDNAFGSGYPGDPVTKRFLTEHIDLVFGFPRLVRFSWSTAEN
ALANKAYDMEFDEPDSEKPKYAGTKLTKFFKGTTKDGEVIREECRFFKQRHLSNVFEF
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaatttatcgtttacaacactagaccgaaaaaaagcaaaaaaggcgcgtagaatggaa
gatataaaaatcaaggaggaaaataaaaccaattccgaaggcgatccatccgatgatgag
gacaagaaggacataggcaaaatcacttcgttaaagtctttgggtcccttcatcgcatcg
cgagagaacagccagaatacggtgtacctcagcgatgtgccggccgtgtgcaaggataag
ccctgcatgctgggcgtcgacgaggcgggcagaggacccgtgctgggtcccatggtctac
ggcatctcctactgcccgctggagagcaagcaggcgctgattgatctcggatgtgcggac
tccaaacaactgacggaggagaagcgggacgtgatcttcaatgagatgaacacgctggag
tatgctaacagctgcgtgggctgggccgtagagatcatctcgcccaacgtcatcagcacg
agcatgtaccggcgagccaagtgttcgctgaacgaggtgtccatggaatcggccatgggt
ctgatccagcaggccatcgatgcgggcgtgaacatagccgaggtctatgtggatacggtc
ggaccgccggagaagtaccaggaaaagctgttgcgacgcttccccaacttcaagatcact
gtggccaaaaaggctgattccacgtatcccattgtctcggcggccagtatctgtgccaaa
gttacccgcgatcacgccctcaaggtgtggcggttccccgagggtctggtcatcaaggac
aatgcctttggcagcggctatcccggggatccggtcacgaaacggtttctcaccgaacac
attgatctggtgtttggcttcccccggctcgtgcgcttcagctggtcgacggcggagaat
gctctggcgaacaaggcctacgacatggagttcgatgagcccgactcggagaagcccaag
tacgcgggcaccaagcttacaaagttcttcaaaggcaccactaaagacggcgaggtcata
cgcgaggaatgccgcttcttcaagcaacgtcacttgtcaaatgtttttgaattttag

DBGET integrated database retrieval system