KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13500Help
Entry
Dpse_GA13500      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpo01002]
    Dpse_GA13500
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpo04147]
    Dpse_GA13500
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dpse_GA13500
Peptidases [BR:dpo01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dpse_GA13500
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dpse_GA13500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_3 Peptidase_S9 Thioesterase Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 4805745
NCBI-ProteinID: XP_001362092
FlyBase: FBgn0073536
UniProt: Q28WJ5
Position
3
AA seq 411 aa AA seqDB search
MSGLYSTINTIFYATIIPGAIFISWLIGLVGLRCLQVCLLFFILVLVVLPLVFRYSVTLQ
RGILFLTFITYPKGLDLTNPAGIGLYATRNFYITVKDNESDEDGVRIGVWHVLPRNAVRR
FKRELKVEEAFDQDIVTDERRDDDYEQELRRLAPAIKSEFPSIVPENQQLFFERLLRMPG
GTVVIYLHGNTATRGSGHRSEVYKLLRNLNYHVLSFDYRGYADSDPVSPTEEGVVRDAMM
VYEYIANVTSNPVIIWGHSLGTGVATHMCARLAHLKERAPRGVILESPFTNIRDEIRLHP
FSRIFKHLPWFDFAISRPMYSNRLRFESDIHVHEFPQPIMIIHAEDDVVVPFHLGYQLYR
IALDSRSRAWGPVEFHRFDRSKRYGHKYLCRAPELPGLVQHFVDNYRNAVY
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggctttatagtactataaacacaatattctatgctacaatcattcccggagcg
atcttcattagttggctaattgggctggtgggcctgcgctgcctccaagtatgcctgctg
ttcttcatcttggtgttggtggtgctgccactggttttccgctactcggtgacgctccag
cgcggcatcctcttcctcacattcatcacctacccgaagggcctcgacctcaccaatcct
gccggcatcggactctacgcgacacggaacttctacataaccgtcaaggataatgaatcg
gacgaggatggggtgcgcattggagtgtggcacgtgctgccgaggaacgcggttcgccgc
ttcaagcgggagctgaaagtggaggaggccttcgaccaggacatcgtaacagatgagcgc
agggacgacgactacgagcaggagctcaggcgcctggctccggccatcaagtcggagttc
ccctcgatcgtgcccgagaaccagcagcttttcttcgagcgtctactacggatgcccggc
ggtaccgtagtcatctatctgcacggcaacacggccacccggggcagcggccaccgctcg
gaggtgtacaagctgctgcggaacctcaactaccatgtcttgtccttcgactatcgcggc
tacgccgactcggatcccgtctcgcccacggaggagggtgtggtccgggacgccatgatg
gtgtacgagtacatagcgaatgtgacctccaatccggtcatcatatggggtcactctttg
ggcacgggcgtggccacgcacatgtgcgccaggctggcccatctgaaagagcgggcgcca
cgcggcgtcatcctagagagcccgttcaccaacatccgagacgagatccggctccacccc
ttttcaaggatcttcaagcacctgccctggttcgacttcgcgatctcgcgacccatgtac
agcaaccggctgcgcttcgagtcggacatccacgtgcatgagttcccgcagcccattatg
atcatccacgccgaggacgacgtggtagtgcccttccacctgggctaccagctgtaccgc
atcgccctcgacagccggagtagggcgtggggacccgtagagttccaccgctttgaccgg
agcaagcggtacggccacaagtatctgtgccgggcgcccgagctgcccggcttggtgcag
catttcgtggataactatcgcaatgccgtctactag

DBGET integrated database retrieval system