KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA13502Help
Entry
Dpse_GA13502      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dpse_GA13502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dpo04030]
    Dpse_GA13502
G protein-coupled receptors [BR:dpo04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    Dpse_GA13502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 4804068
NCBI-ProteinID: XP_001360688
FlyBase: FBgn0073538
Position
3
AA seq 641 aa AA seqDB search
MLKAMTTPATLSAEFAAAAAAAAAAAMDDDVPTSIFEIELPAILLNESLFIELNGNLTQF
EGTTTNLSQIIWNRSDDSSSGSANGNGNGNGSPIFGLDEQRRVVSEREAAEFWLLVKMIA
MAVVLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEI
SNGWILGPELCDIWTACDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFMMIFC
VWFAALIVSLAPQFGWKDPDYLKRIEEQHCMVSQDVAYQIFATCCTFYVPLLVILFLYWK
IYIIARKRIQRRTQKSFNVTLTETDCDSTVRELKKERGKRRVAERKRQEAGDEISAGVTE
PQVQQRTRKRMRICFGRNTNTAGICAGSEGAVARSMAAIAVDFASLAITREETEFSTSNY
DNKSHAGTELTTVSSDADDYRTSNANEIITLSQQVANAAQHHQIASHLNAITPLAQSIAM
GASHLTTSTAGIRSEEGAEAVGGGSSPGKAVGIGMGTVLSSIANPHQKLAKRRQLLEAKR
ERKAAQTLAIITGAFVICWLPFFVMALTMSLCKECDIHPAIASLFLWLGYFNSTLNPVIY
TVFNPEFRRAFKRILFGRGNAARARSAKIXFQLKANEDQYL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagcaatgacgacaccagctacattgtcagcagagttcgccgctgccgctgct
gctgctgctgctgctgcgatggatgacgatgtccccacgagcatttttgaaatagaactg
cctgccattttgctcaacgagagcctcttcatcgagctgaatggcaatctaacccagttc
gaaggcacgaccaccaatttgagccaaatcatttggaatcgcagcgatgacagtagcagt
ggcagtgcaaacggaaacggaaacggaaatggaagccccatcttcggtctggacgagcag
cggcgggtggtcagcgagcgtgaggcggccgagttctggctgctggtcaagatgatagcc
atggccgtcgtgctgggcctgatgatactcgtcaccattataggcaatgtgttcgttatt
gccgccatcatactggagagaaacctgcagaatgtcgccaattacttggttgcatctctg
gcagtcgctgatttatttgtggcctgtcttgtcatgccgctcggcgccgtctacgagata
agcaatggctggatattgggaccggaactttgtgacatttggacggcttgtgacgtcctt
tgctgcacagcatccatattgcatctggtggccattgcggcggacagatattggacggtg
accaacattgactacaacaatctgcggaccccgcggcgcgtcttcatgatgatattctgc
gtctggtttgccgccctgattgtgtccctggcaccgcagtttggctggaaagatccggat
tatctgaagcgcatcgaggaacagcactgcatggtgtcgcaggatgtggcctatcagata
tttgcaacctgttgcaccttctatgtgcctctgctggtgattctatttctgtattggaaa
atctacataattgccaggaagcgcatacaacgacgcacacaaaagtccttcaatgtgacg
ttgacggaaacagattgcgactcgacagtgcgtgagttgaagaaggagcggggcaagcgg
cgcgtggcagagcggaagcggcaagaggctggcgacgagatatccgctggcgtaaccgag
ccgcaggtgcaacagcggacgcgtaagcgaatgcggatctgctttggccgcaacacgaac
acggccggcatctgtgccggctcggagggagccgttgctcgatccatggccgccatagct
gtggattttgccagcctggcgatcacgcgggaggagacggagttcagcaccagcaactac
gacaacaagagccacgcgggcaccgagctgacgacagtctccagtgacgcggacgattac
cgcaccagcaacgctaatgaaatcatcacgctgtcgcagcaggtggccaatgccgcgcag
catcatcagatagcctcccatctgaatgccataacgccgctggcccagtccattgcaatg
ggcgccagccaccttaccacatccacggctggcattcggtcggaggagggcgcagaagca
gtgggcggaggcagcagccccggcaaggccgtgggcattggaatggggactgtgctatcc
agcattgccaatccacaccagaagctggccaagcgccggcagctgctggaggcaaagcga
gagcgcaaggccgcccagacactggccatcatcacaggcgcttttgtcatctgctggctg
cccttcttcgtgatggccctgacaatgagcctgtgcaaggaatgcgacatccatccggcc
attgcctcgctattcctctggctgggctacttcaactccaccctgaatccggtcatttat
accgtgttcaatccggaatttcgaagagccttcaagcggattctctttggccgcggcaat
gcggcgcgggctcgcagtgcgaaaatttgatttcaactgaaggccaacgaggaccagtat
ctatag

DBGET integrated database retrieval system