KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14086
Entry
Dpse_GA14086      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K14810  ATP-dependent RNA helicase DDX56/DBP9 [EC:3.6.4.13]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dpo03009]
    Dpse_GA14086
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Dpse_GA14086
Ribosome biogenesis [BR:dpo03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    Dpse_GA14086
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_30 Helicase_RecD AAA_19 DUF4320
Other DBs
NCBI-GeneID: 4815773
NCBI-ProteinID: XP_001355297
FlyBase: FBgn0074117
UniProt: Q29JE7
Position
XL
AA seq 558 aa
MSSPEKLPKFHELELDHRILKAVSKLGWEQPTLIQGTAIPLLLEGKDVVVRARTGSGKTA
TYALPLIQKILNSKLTATEQCVSAVVLAPTKELCRQSRAVIEQLAEYCHKVVRVADISGT
TSNTVTERHALAERPDIVVATPAKLLNHAKADGVVDLKKVETLVVDEADLIFAFGYEMDF
KALLKHLPSIYQSVLVSATLSDDVVRMKGLCLHNPVTLKLEEPDVVSQDQLTHQRILAEE
NDKPVILYALLKLQLIRGKTIIFVNTIDRSYKIRLFLEQFGIRACVLNPQLPASIRINMI
SQFNKGTYDIIIASDQHYLERPDNGSQDKRKSTRGDFESSASRGIDFQSVNNVINFDFPL
DVTSYIHRAGRTARGNNKGSVLSLVSIKESGVNDAVEKKLRITFSAKKGDTIIKNYQFKM
DELESFRYRAYDAWRAASRAAVQETRLREIKTEVLNSVKLKGYFEDHQRDLNALRHDKPL
RILKTPSHLSDMPEYMVPKVLKRVVVSKASGPADESSDAKRPRQTAAKAAFDRKTNDPLM
VEFGNRRPAPRQKKKKPL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgagcagcccagaaaagttaccaaagttccatgaacttgagttggaccatcgtattctc
aaggcagtatcgaagctgggatgggagcagcccacgctgatccagggcacggcgattccc
ctgctgcttgagggcaaggatgttgtagttcgcgctcgcaccggctccggcaagacggcc
acctatgccttgcctctgatacagaaaattctcaactctaagctcactgccaccgaacaa
tgtgtgagcgccgtggtactggccccaaccaaagagctgtgtcggcagtcacgcgcagtc
atcgagcagctggccgaatactgccacaaggttgtgcgtgttgcggacatttccggaaca
acaagtaatactgtgactgaacgacatgccctcgccgagcgccccgacattgttgtggcc
actccagccaagctactgaaccatgccaaggccgacggtgtggtagacctgaagaaagtc
gagactctggtggtggatgaggcagatctgatatttgcattcggctatgaaatggatttc
aaggcattacttaaacatctgccttccatataccaatcggtgcttgtctcggccaccctt
tcagacgacgtggtacgcatgaagggactgtgcctccacaatccagtcacgctaaagctg
gaggagcccgatgtagtgtcgcaggatcagctaacccaccagcgcatcctggcggaagag
aacgacaagccggtcatcctgtacgccttgcttaagctgcaactgatacgcggcaagacc
attatatttgtcaacaccatcgatcgcagctacaagattcgcttgtttttggagcagttt
ggcatacgggcctgcgttctcaacccgcagctgccggcctcgattcgcatcaacatgatt
agtcagttcaacaaaggcacctacgacatcatcattgcctccgatcagcattatctagag
cggcccgataacggttcacaggacaagcgcaaatcaacgcgcggcgatttcgagtctagc
gcctcgcgtggcatcgacttccagtcggtaaacaatgtgattaactttgactttccgctc
gatgttacctcatacattcatcgcgctggacgcacggccagaggcaacaacaagggctcc
gttctgtccctcgttagcatcaaggagtctggcgtaaacgatgccgtagagaagaagctc
cgaataaccttcagtgccaaaaagggcgacacgatcattaaaaactatcaattcaaaatg
gacgaactggagtctttccgctaccgtgcttacgacgcctggcgtgctgcctctcgtgcc
gccgtccaggagacccgtttacgcgaaatcaaaaccgaggtgctcaacagcgtgaagctc
aagggctacttcgaggatcaccaacgcgatctgaacgctctgcgtcacgacaagccgctg
cgtatcctcaaaacgccaagccatttgtccgacatgcccgaatacatggtccccaaggta
ctcaaacgtgtcgttgtctctaaagcctctggccctgccgacgagtcctcggacgccaaa
cgccctcgtcagacagccgccaaggcagccttcgaccgaaagaccaacgatcccctaatg
gttgaatttggcaatcgacgccctgcccccagacaaaaaaagaagaaacccttgtag

DBGET integrated database retrieval system