KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14145
Entry
Dpse_GA14145      CDS       T01032                                 

Name
(RefSeq) uncharacterized protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB
Motif
Pfam: Band_7 Band_7_C Band_7_1
Other DBs
NCBI-GeneID: 4803529
NCBI-ProteinID: XP_001360240
FlyBase: FBgn0074174
Position
3:1783924..1788338
AA seq 361 aa
MALLWQTLPQRPRFLLAGHWVTTQFRGKTSTPMNTVVMFVPQQEAWVVERMGRFHRILDP
GLNVLVPIADKIKYVQSLKEIAIDVPKQSAITSDNVTLDIDGVLYLRIIDPYRASYGVED
PEFAITQLAQTTMRSELGKMSLDKVFRERESLNVSIVDSINKASEAWGIACLRYEIRDIR
LPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAEGKRKSRILASEAERQEHINKAS
GEAAAIIAVADARARSLQAIAKSLAHIDGKNAASLTLAEQYIGAFKQLAKTNNTMILPSN
AADVNGFVAQALAVYNHVSSSNQSSIEHTAHVKNVASCLNTNNIEYNQMNDEKKSVKMNI
E
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggctctcctatggcagacactaccacaaagaccaagattcctgcttgccggccattgg
gtcaccacgcagttccgcggaaagacatcgactcccatgaacaccgttgtaatgttcgta
ccacaacaagaggcgtgggtagtggaacgtatgggtagatttcatagaattcttgacccc
ggcctcaatgttttggttccaatcgcggacaaaatcaagtatgtgcagagcctgaaggaa
attgcgatagatgttccgaaacagagtgctattacatctgacaatgtcactcttgatatt
gatggagtgctttacttgcggatcattgatccatacagagcgtcttacggtgtggaagat
ccggagtttgctataacacaactcgcccaaaccacaatgaggtccgagctggggaaaatg
tcattggacaaggtgtttcgagaaagggaatcactaaacgttagcattgttgattccatc
aacaaggcaagcgaagcgtggggtattgcttgtctgcgttacgaaattcgagatatacga
ctaccaacaagagtccatgaagcaatgcaaatgcaagtcgaagcggaaagaaggaaaaga
gcggctatattggagtcggaaggcgttcgtgaagccgaaattaatattgctgaaggcaaa
agaaagtcgagaatactggcatccgaggctgaacggcaggagcatataaacaaagctagc
ggggaagctgctgccattattgccgtagcagatgcaagagctcgtagcctgcaggccata
gcaaagtctctggcgcacattgatggaaagaatgctgcttccctcactctagccgagcaa
tacattggagcgtttaagcaactggctaaaacaaataatactatgatattgccgtctaac
gccgcagatgtaaacggatttgtggcgcaagccctggcagtgtacaatcatgtttccagc
tcaaaccagtccagcatcgagcatacggcacatgtcaaaaacgttgcttcttgtctcaat
accaataatattgagtacaatcagatgaatgatgagaaaaagagtgtaaaaatgaatatt
gaataa

DBGET integrated database retrieval system