KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14392Help
Entry
Dpse_GA14392      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00010  Glycolysis / Gluconeogenesis
dpo00260  Glycine, serine and threonine metabolism
dpo01100  Metabolic pathways
dpo01200  Carbon metabolism
dpo01230  Biosynthesis of amino acids
Module
dpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dpo_M00002  Glycolysis, core module involving three-carbon compounds
dpo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dpse_GA14392
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dpse_GA14392
Enzymes [BR:dpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dpse_GA14392
Membrane trafficking [BR:dpo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dpse_GA14392
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dpse_GA14392
  Exosomal proteins of melanoma cells
   Dpse_GA14392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 4801166
NCBI-ProteinID: XP_001358300
FlyBase: FBgn0074420
UniProt: Q29AB2
Position
2
AA seq 255 aa AA seqDB search
MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSDKGKEEAQAAGKAVKDAGLEFDVAHTSV
LTRAQVTLASILQASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSF
DTPPPPMEPGHAYYDNIVKDPRYADGPKPEEFPQFESLKLTIERTLPYWNEVIIPQMKEG
KRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEET
VKKAIEAVAAQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaaagtacaagattgtgatggtccgccacggcgagtccgaatggaaccagaag
aatcagttctgcggctggtacgatgccaatctgagcgacaagggcaaggaggaggctcag
gccgctggcaaggccgtgaaggacgctggtctggagttcgatgtggcccacacttcggtg
ctgactcgcgctcaggttaccctggcaagcattctgcaggccagcggccacaaggagatc
cccatccagaagacctggcgtctgaatgagcgtcactacggtggactcactggcctgaac
aaggcggagactgccgccaagtacggtgaagctcaggtgcagatctggcgccgcagcttc
gacacaccgccaccaccaatggagccaggacacgcctactatgacaacattgtcaaggat
cctcgctacgccgatgggcccaagcccgaggagttcccccagtttgagtcgctcaaactg
accatcgaacgcacactgccatactggaacgaagtgatcattccccagatgaaggagggc
aagcgcatcctgatcgcagcgcacggcaacagtctgcgtggcatcgtcaagcatttagat
aatctgtctgaggacgccatcatggccctgaacttgcccactggcataccattcgtctat
gagctggacgagaacttcaagccagtggtgtccatgcagttcctcggcgatgaggagacc
gtcaagaaggccatcgaggctgtcgctgcccagggcaaggccaagtaa

DBGET integrated database retrieval system