KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14510
Entry
Dpse_GA14510      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K14963  COMPASS component SWD3
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpo03036]
    Dpse_GA14510
Chromosome and associated proteins [BR:dpo03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    ATAC complex
     Dpse_GA14510
    NSL complex
     Dpse_GA14510
   HMT complexes
    COMPASS/SET1 complex
     Dpse_GA14510
    COMPASS/SET1 complex (yeast)
     Dpse_GA14510
    MLL-HCF complex
     Dpse_GA14510
    MLL3/MLL4 complex
     Dpse_GA14510
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Nup160 WD40_like Ge1_WD40 VID27
Other DBs
NCBI-GeneID: 4815574
NCBI-ProteinID: XP_001355636
FlyBase: FBgn0074538
UniProt: Q29IF8
Position
XL
AA seq 356 aa
MVPIGPVHPNHPGVVHPPQQPMPTAPTGPNSLQPNANVSGSSNSTSNKSSMSVKPNYTLK
FTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD
SRLLVSGSDDKTLKIWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDV
RTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVS
FVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGS
EDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggtgcccattggacccgttcatcccaaccatcccggcgttgtgcatcccccacaacag
ccgatgccgacagcgcccaccgggcccaattctcttcagcccaatgccaatgtctcggga
tcctcgaactccacctcgaacaagagctctatgtcggtgaagccgaactatacgttgaag
tttactcttgccggccacaccaaggcggtctctgcggtcaagttcagcccaaacggcgaa
tggctggccagctcatctgctgataaactgattaaaatctggggagcgtacgatggaaaa
tttgagaagactatctccgggcataagctgggcattagcgatgtcgcctggagctcggac
tcgcgtctactggtcagcggcagcgacgataagaccctcaagatttgggagctgagcact
ggcaagagcctcaagacgctcaaggggcacagcaactatgtgttctgctgcaactttaat
ccgcagtcgaacctgattgtctctggcagctttgatgagagcgtacgcatttgggatgtc
cgtactggcaagtgcctgaagacactgcccgcccactctgatcccgtgtcggcggtgcac
ttcaatcgcgatgggtcactgattgtcagctctagctacgacggactgtgccgcatctgg
gacacggccagcggacagtgtctgaagacgctaatcgacgacgacaatccgcccgtcagc
tttgtcaaattctcgccgaacggcaagtacatcctggcggccactctggacaacactctc
aagctgtgggattactccaagggcaagtgtctcaagacctacacgggtcacaagaacgag
aagtactgcatatttgcgaatttctctgtcaccggcggcaagtggatagtcagtggtagc
gaggacaatatggtctatatatggaatctgcaaagcaaggaggtggtgcaaaagctgcag
gggcacaccgatactgtactctgcactgcctgccatcccaccgagaatatcatcgcctcc
gctgcgctcgagaacgacaagaccataaaactgtggaaatcagacacatag

DBGET integrated database retrieval system