KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14542
Entry
Dpse_GA14542      CDS       T01032                                 

Name
(RefSeq) uncharacterized protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00480  Glutathione metabolism
dpo00980  Metabolism of xenobiotics by cytochrome P450
dpo00982  Drug metabolism - cytochrome P450
dpo00983  Drug metabolism - other enzymes
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dpse_GA14542
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dpse_GA14542
   00982 Drug metabolism - cytochrome P450
    Dpse_GA14542
   00983 Drug metabolism - other enzymes
    Dpse_GA14542
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpo02000]
    Dpse_GA14542
Enzymes [BR:dpo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dpse_GA14542
Transporters [BR:dpo02000]
 Other transporters
  Pores ion channels [TC:1]
   Dpse_GA14542
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Glutaredoxin Thioredoxin_8
Other DBs
NCBI-GeneID: 5495503
NCBI-ProteinID: XP_001361310
FlyBase: FBgn0074570
UniProt: A0A6I8UV00
Position
3
AA seq 221 aa
MGKISLYGLDASPPTRACLLTLKALELPFEYVFVNLLTKENFAEDYMKKNPQHTVPMLQD
DDDYIWDSHAIMAYLVGKYAETDELYPKDLLQRAVVDQRMHFESGVIFEGALRRLTRPVL
FLGGTTLPQANVDQVNEVYDFLETFLDNDFVAGDHLTIADFSIVSSISSLGVYLEHDPVK
YPKTTAWLQRLKELPYYEEANGSGATQFMQLIKSKNFTIVP
NT seq 666 nt   +upstreamnt  +downstreamnt
atgggtaagatttcgctgtacggcttggacgccagtccacccacccgggcttgcctgctc
accctgaaggccttggagctgcccttcgagtacgtcttcgtgaatctacttactaaagag
aacttcgccgaggactacatgaagaagaatccccagcatacggtgcccatgctgcaggac
gatgatgactacatatgggactcgcatgcaatcatggcctatctggtgggaaagtacgcg
gagaccgacgaactgtaccccaaggaccttctgcagcgggctgtggtcgatcaacggatg
cacttcgagtcgggggtcatcttcgagggcgccctgcgtcgtctcaccaggccggtgctg
ttccttggcggcaccaccctgcctcaggccaatgtagaccaagtcaacgaggtctacgac
ttcttggaaacgtttctggataacgactttgtggccggtgatcacctgaccattgccgac
ttcagcattgtgtcgagtatcagctcgctcggcgtctacttagagcacgatccggtgaag
tatcccaagacaacagcctggctgcagcgcctcaaggagctgccctactatgaggaggcg
aacggcagtggagctacccagttcatgcagcttataaagtccaagaacttcaccatcgtg
ccctag

DBGET integrated database retrieval system