KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15191
Entry
Dpse_GA15191      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08497  protein transport protein SEC20
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    Dpse_GA15191
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpo04131]
    Dpse_GA15191
Membrane trafficking [BR:dpo04131]
 SNARE
  SNAP-25[N] (Qb)
   Sec20
    Dpse_GA15191
SSDB
Motif
Pfam: Sec20 V-SNARE_C Prominin PSD2 PilJ
Other DBs
NCBI-GeneID: 4801480
NCBI-ProteinID: XP_001358565
FlyBase: FBgn0075216
Position
2
AA seq 227 aa
MDKDKFTLQSIRQDLIDNNLQAKAIIQDIVNSRTSISELEELNEAGRARLSAIRKSIERL
DDWARDMADTSLAKEVDTHRDQFSKTLQAFRKANVATMLEIEKANREELMAITGESELRQ
RTTARARHNQGSLVSQENDVTEKMLAISRHLSETTQKSAVTLETLVASSQNVEATSDELH
HTAGSIKMSGKLLKKYGRRECTDKMLVFFAFCLFLVCVFYIVQKRLF
NT seq 684 nt   +upstreamnt  +downstreamnt
atggacaaggataaattcacgctacagtccattcggcaagacctcattgacaacaatttg
caagccaaggcaattattcaggacatagtaaacagtagaacatccatttccgagcttgag
gagctgaatgaagctggacgggcaaggctgtcggccattcgcaaaagcatcgagcgcttg
gatgactgggcacgggacatggccgacacatctttggcgaaggaggtggacacacatagg
gatcaattctccaaaacattgcaggcattccgcaaagcaaatgtggcgactatgctggag
atcgaaaaagccaaccgagaggagctaatggccataactggcgagagtgagttgcggcaa
cggaccacagcgagagcacgacacaaccagggcagtctggtgtcgcaggagaacgatgta
accgagaaaatgctggccatttcgcggcatctgtcggagactacgcagaaaagcgccgtc
acgctggaaaccctagtggcgtcgtcacagaatgtggaagccacaagtgacgagctgcat
cacacagccggcagcattaaaatgtccggaaagctgctgaaaaagtacggtagacgcgaa
tgcaccgacaagatgctggtattctttgcgttttgtctgttccttgtttgtgtcttttac
attgtacagaagcgactgttttag

DBGET integrated database retrieval system