KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15379
Entry
Dpse_GA15379      CDS       T01032                                 

Name
(RefSeq) uncharacterized protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Peptidase_S9
Other DBs
NCBI-GeneID: 4802964
NCBI-ProteinID: XP_001359777
FlyBase: FBgn0075398
UniProt: A0A6I8URJ7
Position
2:26777074..26779455
AA seq 654 aa
MYSRALPRPDRLAGYVARRLSYPERQKAPAIAVASRIPSKPMRFQSHLASQPYWIQRFAP
LPHRIGKSNTVFWRTSFRTQQNSQQHEKMEVQVGWQKLLKMGAKLVGHKYQQYRLATNNT
VVLDTENGQVMGLQRKTLYDEELYYAFEGIPYAKAPIGELRFRAPEPAEPWKGVLNCTTY
RSKPMQRNMVMGIIEGSEDCLHLNVYAKTLQSEQPLPVIVWIYGGGFQKGEASRDIYSPD
YFMKQPVVFVCINYRLGALGFLSLKDPKLNVPGNAGLKDQVMALRWISDNIAHFNGDPDN
ITLMGESAGAASTHIMMTTEQTRGLFHKAILQSGCALSEWVESPDHQWAYRLAQQMGYKG
GEKDADVLKYLTKISARQIANTDQDIITREEIRSFLLFAFGPVVEPYETSHCVVPVRHKD
MLPHAWSNDIPVIVGGNSFEGLFSYQLLRGDPWAQSHFHNIIPREVSEAATEEQRDELVG
RLKKVYFDDEKRDKMGFFEALNIFSHRQIWHDLHRVVMSRLAYAPTQPTYLYRFDFDSPH
FNQFRRLVCGDRIRGVSHADELSYMFYNIISPKISKSSQEYHTIERMVGMWTAFAATGDP
NCPAIAPAEWLPVERTENGVEHCLNISQKLEMIELPEAETLAVWDSFYTKEALY
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgtattcacgtgcgctgccgcggccggaccggctggctggctacgtcgcgagacgtcta
tcttacccggagcgccaaaaagcgccggcaatcgcagtcgcatcacggatcccatccaaa
cctatgcgatttcagtcgcatctggccagccagccttattggatccagcggttcgcgcct
ttacctcatagaattggaaaatccaataccgtattttggagaacatcattccgtacacaa
caaaattcgcagcaacacgaaaagatggaagtccaagtaggctggcagaaattgctcaaa
atgggggccaagctcgttgggcacaaataccaacagtaccggctggccaccaacaacacc
gtcgtgctggacacggaaaatggccaggtgatggggctgcaacgcaagaccctctacgac
gaggagctgtactatgccttcgagggtataccgtatgcaaaggcacccattggagagctg
cgtttccgtgcccccgagccggcagagccctggaagggtgtgctcaactgcaccacctat
cgatcgaagcccatgcaaaggaatatggtgatggggataatcgagggttccgaggactgc
ctgcatttgaatgtgtatgcaaagacgctgcagtcggagcagccactgcccgtcatcgtg
tggatctatggcggtggttttcagaagggcgaggcctccagggacatctacagccctgac
tatttcatgaagcagccagtagtctttgtttgcatcaactacaggcttggagctttgggt
ttccttagccttaaggaccccaaactgaatgtgcccggcaatgcagggctcaaggatcag
gtgatggccctgcgctggatcagcgacaacattgcacacttcaatggcgaccccgacaac
atcacactaatgggcgagagtgctggggccgcctccacgcacatcatgatgaccaccgaa
cagacgcgtggcctcttccacaaggccatccttcagtcgggctgtgctctgagcgaatgg
gtggagagccccgaccaccagtgggcgtatcggttggcccagcagatgggatacaagggc
ggcgaaaaggatgcggatgtcctgaaatatctgaccaaaatatcggcccgccagatagca
aacacggaccaggacatcatcacccgggaggagatacgcagcttcttgctgttcgccttt
gggccagtggtggagccgtacgagacgtcacattgtgtggtgccggtcaggcacaaggac
atgctgccccatgcctggagcaatgacattcccgtgattgtgggaggcaactctttcgag
ggcctcttctcgtatcagctcctgcgcggcgatccctgggcacagagccatttccacaac
atcattccacgcgaggtgagcgaggcggccaccgaagagcagcgcgacgagctggtggga
cgcctcaagaaggtctacttcgacgacgagaagcgcgataaaatggggttctttgaggcc
ttgaacatattctcgcatcgccagatctggcacgatctgcatcgcgtggtcatgtcccgc
cttgcctacgcccccacacagcccacctacctctatcgctttgactttgattcgccgcac
ttcaaccagttccgtcgcttggtctgcggcgatcgcatccgtggtgtgtcccatgccgat
gagctctcctacatgttctacaacatcatatcgccaaagatcagcaaatcctcgcaggaa
taccatacaattgaacgtatggtgggcatgtggacggcatttgcagccaccggagatccc
aattgcccggccattgcccccgccgaatggctgcccgttgagcggaccgaaaacggtgta
gagcattgcttgaacatcagccaaaagctggagatgatcgagcttcccgaggcggaaaca
ctggccgtgtgggacagtttctataccaaagaggcgctctattag

DBGET integrated database retrieval system