KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15903
Entry
Dpse_GA15903      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K24132  serine protease 7 [EC:3.4.21.-]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpo01002]
    Dpse_GA15903
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     Dpse_GA15903
Peptidases and inhibitors [BR:dpo01002]
 Serine peptidases
  Family S1: chymotrypsin family
   Dpse_GA15903
SSDB
Motif
Pfam: Trypsin CLIP Trypsin_2
Other DBs
NCBI-GeneID: 4802972
NCBI-ProteinID: XP_001359782
FlyBase: FBgn0075919
Position
2:27014969..27016883
AA seq 383 aa
MKSTFQSLGVFVTCLLVLVQAQESCRNPNQRQGYCVSLYDCPTLLSVVQQSSVSSEDRSF
LVNSQCYNGIGRQPHVCCTNDRGYGAADTTTQRSVIVSSRPTVFGGQQGPGNLLPVPPKC
GPHSFSDKVYNGNDTALDEFTWMALLEYVDRKGQRQLSCGGSLINNRYVLTAAHCVTGEV
ATQVGQLTSVRLGEYDTSKDIDCIAGDCNPPYIERSIEQTIVHPEYDAASRHRYHDIALL
RLAEPVTLNEYIQPVCLPLATTRQAINVGEQLVVSGWGRTTTARKSNIKQRLSLPVNDHE
SCVRKFATRQINLIGAQLCAGGEFYRDSCDGDSGGPLMRRGFEQAWFQEGVVSFGNRCGL
EGWPGVYTSVRDYMDWIESTLRP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgaagtcaacattccagtcgctgggggtttttgtcacctgcctcctggttctagtgcaa
gcccaagaaagctgtagaaatcccaaccagcggcaaggctactgtgtatcgctctatgac
tgtccgactctgctaagtgtcgtccagcagagttctgtgagcagcgaagatcgctctttc
ctggtcaactcccagtgctacaatggcattggtcgccagccacatgtctgttgcaccaac
gataggggatacggggctgcagacacaaccactcagcgatcggtgattgtcagcagtagg
cccacggtgtttggtggccaacaggggccgggtaatctactgccggtgcctccaaagtgt
ggtcctcattcgttcagcgataaggtctacaatggcaatgacaccgctttggatgagttc
acctggatggctctcttggagtatgtggatcgcaaaggtcagcgacagctaagttgcggt
ggaagtctgatcaacaatcgttatgtcctgacggctgcacattgtgtcacaggggaagtg
gccacacaagtcggacaattaacttctgtacgcctgggcgaatacgacactagcaaggat
atcgattgtatcgccggtgattgcaatcccccctacatagagcgctccattgagcagact
attgtccatccggaatacgatgccgcaagtcgtcatcgctaccatgacattgccctgctg
cgtctggcggagcctgtgacactcaacgagtacattcagccggtgtgcctgccactggcc
acaacccgccaggcgatcaacgtgggagaacagctggtggtcagcggttggggaagaaca
accacagcacgcaagagcaacatcaagcagaggctctctctgcccgttaacgatcacgag
tcctgtgtccggaagtttgccacgcggcagatcaatctgatcggcgctcagctctgtgcc
ggcggggagttctaccgcgacagctgtgatggcgactccgggggtccgctgatgcgaagg
ggcttcgagcaggcctggttccaggagggcgtggtctcctttggcaatcgctgtggtctc
gagggctggccgggcgtttacacctctgtgagggactacatggattggatcgagagcacg
cttcggccttga

DBGET integrated database retrieval system