KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15916Help
Entry
Dpse_GA15916      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpo01001]
    Dpse_GA15916
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dpse_GA15916
Protein kinases [BR:dpo01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   Dpse_GA15916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 4814374
NCBI-ProteinID: XP_001354449
FlyBase: FBgn0075932
UniProt: Q29FS7
Position
XL
AA seq 358 aa AA seqDB search
MLSLQNQRQPKTSALVDDYEISDTVLGLGINGKVVQCTNRRTKQNYALKVLLDNEKARRE
VDLHWRVSGCKHIVNIIDVYENTYSGRKCLLVVMECMEGGELFQRIQDKADGAFTEREAA
QIMHEICAAIDYLHSRDIAHRDLKPENLLYTTSQPNAILKLTDFGFAKETFTNDTLQTPC
YTPYYVAPEVLGPEKYDKSCDIWSLGVVMYIIMCGFPPFYSNNGLAISPGMKKRIRTGQY
DFPDPEWTNVSQSAKDLIKGMLNVDPSKRLRIQDVIRNKWIAQYNAVPQTPLCTGRMLKE
GEETWPEVQEEMTRSLATMRVDYDQMQIKALDKSNNPLLTKRRKKIEEIYGTNATARN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgctgcagaatcaacggcaaccgaaaacaagcgccctggtggacgactatgag
atctcggacacggtgcttggcctgggcatcaacggcaaggtagtacagtgcaccaatcga
cgcaccaaacagaactatgcactcaaggtgttgctggacaatgagaaagcccggcgtgag
gtcgatctccattggcgtgtgagtggctgcaagcacatcgtcaacatcattgatgtctat
gaaaacacgtacagcggtcgaaagtgtctgttggttgtgatggaatgcatggagggcggt
gagctcttccagcgcattcaggacaaggccgatggggcctttacggaacgcgaggcggca
cagataatgcacgagatatgtgcggcaatagactatctgcacagtcgcgatatcgcgcat
cgcgatcttaagcccgagaacttgctctacaccacatcccagccaaatgcgatcctgaag
ctgacagacttcggttttgcaaaagagaccttcaccaatgacaccctccaaacgccctgc
tatacaccgtactatgttgcgcccgaagtactgggccctgagaaatacgacaaaagctgc
gacatttggtcgctgggagtggtcatgtacattataatgtgcggctttccgccgttctac
agcaacaatggtttagccatttcgccgggtatgaagaagcgcatccgcacagggcagtac
gattttcccgatccggaatggacgaacgttagccagtcggctaaggatttgatcaagggc
atgctgaacgtggaccccagcaagcgtttgcgcatccaagacgtaatacgcaacaagtgg
attgcccagtacaatgccgtgccacaaacacctctgtgcactggccgcatgctcaaggag
ggtgaggagacctggccggaggtacaagaggaaatgacccgctccctggccaccatgcga
gtggactacgatcagatgcaaattaaggcgctggacaagtcgaacaatccactcctgaca
aagcggaggaaaaagattgaggagatctatggaacaaatgctacggcacggaactag

DBGET integrated database retrieval system