KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA16721
Entry
Dpse_GA16721      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein, isoform H
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank PRKG1_interact Ank_5 Ank_3 DUF4695 NuiA
Other DBs
NCBI-GeneID: 4813317
NCBI-ProteinID: XP_001353269
FlyBase: FBgn0076736
UniProt: A0A6I8UCM5 Q2M104
Position
XR
AA seq 1157 aa
MSTLDARNNSAMMKRAEQLKRWEESDTNRAAPTPRHEHGRRIKFSSGCVFLAACLSGDKD
EVIQLLDQGADINTANVDGLTALHQACIDDNLHMVEFLVKRGADINRQDNEGWTPLHATA
SCGFVSIARYLVENGADVAAVNSDGDLALDLAIDVQHRGMIEYMEKIVQELNIDVEQARK
AEEEAMLSDAERWLSSDAAEVDRPHPKTGATALHVAAAKGYTNVLSLLLEGRGNVDRQDN
DGWTPLHAASHWGQQETSRMLVESLADMDIRNYAGQSCIDVADRKIVKFLEELRAKNRNQ
RRPSSQIRISDAIENRVDKTPTKLVRVEVRTDATKDAENVKPNQQQIHALEHPVEEEAPW
RRKMARAPNDSPTNNQVPDRELSSNSSESANDVILRRTQSFENDEKKPTVTHVGTPTGTA
ATAKTTLLSSPSTNALTPPIRSQVTAKTTAQSNNGSSSTASASASASASDAETAKPPPKQ
STGNIIKNFFKSFVPPVRDEESETQRKAHAKRVRETRRSTQGVTLDEIKSAEELVKKKNM
GMANNNNNNNNNISSSGSNDTSETAAATATSEHTSSISDASQQEPQPPPPPTTPPPAIIP
TSDETEIETILAPSPVQSANDTTASFTLSAPSRRSVVVDDDDDGDGDGDGKAGGDADDPE
AVVSASYTIVSRRDKIPDSAESEPEQVESNKQKTDEQQAESEEQKARPTDLPLSAAPTEA
IKSSSSTTPGSLESPVRLRDKRGLSGSSQETDTKSDTASPVSAHPDFNARDSLLSLYARR
TTDGSGGASAAAAAAAATATGGAGTGAGGAGGSSTSTSTAERRPSWRLKFDAGSKFKLED
NTSGGTYPPNNSTIIPSAPAVMAAANLSTTTGIQRRISSGPNALNASNQSLNSVGRPISA
PSESTNNSSAYATPAVRKYETTSTGAGTGVGARVGAAATTTATTTANSVSATSANHAAGT
AATTNATSSHDDKENDKENDNRTQTVIQRRRKPKRRSTGVVHLDVDELDPERQNEEKDKE
SGSERTSRSRLGSTTSTAATSTTRSESKGSSDKSENGDGIDYKALWEAAKLENDKLKQVL
KQKDDEVVQTRATLERFANATTKNSLSEIEKRERRAMERKLSELEEELKQLDAYKSDNHR
LKEENAALIRVISKLSK
NT seq 3474 nt   +upstreamnt  +downstreamnt
atgtccaccctggacgcgcgcaacaactcggccatgatgaagcgggccgagcagctgaag
cgctgggaggagtcggacaccaaccgggccgcgcccacgccccgccacgagcacgggcgc
cgcatcaaattcagctccggctgtgtcttccttgccgcctgcctctccggcgacaaggac
gaagtgatccagctgctcgaccagggcgccgacatcaatactgccaatgtggacggccta
acggccttgcatcaggcctgcatcgatgacaatctgcacatggttgagtttctggtgaag
cgtggtgccgacatcaaccgtcaggacaacgagggctggacgccgctgcatgccaccgcc
tcctgcggatttgtgagcatagcacgttatctggtggagaacggggccgatgtggccgcc
gtgaacagcgacggggacttggccctggacctggccatcgatgtgcagcacaggggcatg
atcgagtacatggagaagatagtccaggagctgaacatcgatgtggagcaggcgcgcaag
gccgaggaggaggcgatgctgagcgacgccgagcgctggctgagcagcgatgccgccgag
gtggacaggccgcacccgaagacaggggccacggcgctgcacgtggccgccgccaagggc
tacacgaacgtgttgagcctgctgctggagggacgcggcaatgtggatcgtcaggacaac
gatggctggacgccgctgcatgccgcctcgcactggggccagcaggagacctcccggatg
ctggtcgagtccctggccgacatggatatacgcaactatgcgggacagtcctgcatcgat
gtggccgaccgtaaaatagtcaaattcctggaagaactgcgggccaaaaatcgcaaccag
cggcgtccatctagtcaaatcagaatctcagatgcgattgaaaatcgtgtggacaagacg
cccaccaaactggtgcgcgttgaagtgagaactgatgccacaaaggatgcggagaacgtg
aagcccaatcaacagcagatccatgccctcgagcatccagtcgaggaggaggcaccctgg
cgacgcaagatggcccgcgcacccaacgacagtcccactaataatcaagttcctgataga
gagcttagcagcaatagctcggagagcgccaacgatgtcatattgcgacgcacccaaagc
tttgagaatgatgaaaagaaaccgaccgttacacacgtgggcacgcccactggcacagca
gccacagcaaagacaacgctcctcagttcaccgtcgacgaatgcactgaccccaccaata
cgcagccaagttacagcgaaaaccactgcccagagcaataatggcagctcttccacggcc
agtgccagtgctagtgccagtgccagcgatgcggagaccgccaagccaccgcccaagcaa
tccacgggcaatataatcaagaatttcttcaaatcttttgtaccgcccgtgcgtgacgaa
gagagcgaaacacagcgcaaagcgcatgccaagagagtccgcgagacgcgtcggtccacc
cagggcgttaccctggacgagatcaagagtgccgaggagttggtcaagaagaagaacatg
ggcatggccaacaacaacaataataacaacaataacatcagcagcagcggcagcaacgat
acaagcgaaacagcggcagccacagccacatcagaacacacatcatccatcagtgatgca
agccagcaagagccacagccgccaccaccgcccaccacgccgccgccagccataatcccc
accagcgacgagacggagatcgagaccattctggcccccagtccagtgcaaagtgcaaac
gacaccactgccagcttcaccctctccgcgccgtcgagacgctctgtggtggtcgacgac
gacgacgacggcgacggcgacggtgatggcaaggccggtggcgatgccgatgatccggag
gcagtggtcagtgccagctacacgatagtctcgcggcgcgacaagatccccgacagcgct
gagagtgagccagagcaggtggaatcaaacaaacaaaagactgacgagcagcaggcggag
agcgaggagcagaaggcgaggcccacagacctgccgctgagtgcggccccgactgaggcc
atcaagtcgtcctcatcgaccacgcccggctcgctcgagagtccagtgcgcttgcgggac
aagcgtggcctgtccggcagcagccaggagacggataccaagtcggacaccgcctcgcca
gtgtcggcgcatccggactttaatgcccgcgactctctgctcagtttgtatgcgcgccgc
acgacggacggcagtggaggagcatcagctgcagcagcagcagcagcggcaacagcaaca
ggtggtgctggtactggcgctggtggtgcgggtgggagttccacatcaacatcgacagcg
gaacggcgtccgtcttggcgcctcaaattcgatgccggctccaagttcaagctggaggac
aacaccagcggcggtacatatccgcccaacaacagcaccattatacccagcgccccggcg
gtgatggccgccgccaatctatcgaccacaactggtatccagcgacgcatcagcagtggt
cccaatgccctcaacgcttccaatcagtcactgaactctgtgggccgccccatctcggcg
cccagcgagagcacaaacaacagcagcgcctatgccacgccagcagtgcgcaaatatgaa
acgacatccacaggagcgggaaccggagtgggagcgagagtgggagcagctgctactacg
acagccaccacaaccgccaattcagtgtctgcaaccagtgccaatcatgcagcaggaaca
gcggcaacaaccaatgccacatccagccatgacgataaggaaaacgacaaggagaacgac
aatcgcacacagaccgtcatacagagacgccgcaagccgaagcgcagatcgaccggcgtg
gtgcaccttgatgtggatgaactggatcccgaacgtcagaacgaggagaaggacaaggag
agcggcagcgaacgcacctctcgctcccgactgggcagcacaacgagtacggccgcaacg
agcacgaccaggagcgagtcgaagggcagcagcgacaagtcggagaacggcgatggcatt
gactacaaggcgctctgggaagcggccaaattggagaacgataagctgaagcaagtgctc
aagcagaaggatgacgaggttgtgcagacccgcgcgaccctcgagagattcgccaatgcc
accactaaaaactcactctctgagattgagaaacgtgaacgaagagctatggaacgcaag
ctctccgagttggaggaagagctcaagcaactcgatgcgtacaagtcggataatcatcgc
ctgaaggaggagaacgcggcgctgattagagtaattagcaaattaagtaaatga

DBGET integrated database retrieval system