KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17351Help
Entry
Dpse_GA17351      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17434  large subunit ribosomal protein L53
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dpo03011]
    Dpse_GA17351
Ribosome [BR:dpo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Dpse_GA17351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 DUF3945
Motif
Other DBs
NCBI-GeneID: 4804376
NCBI-ProteinID: XP_001360947
FlyBase: FBgn0077364
Position
3
AA seq 152 aa AA seqDB search
MSVPFSGTLRRSGGIVSAIGKQLKSINLKGVKRITVQFDPFAENVKSTREFFFLLSTPKV
IQTNPKCVVKSDIVCDRQAASIKFALIDSAQEQAKVKEIRFNSGNLNTLELLELCNKHVS
SLAPPEEVTNKVLTKAEKQKLGGGSKKALKKK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgccatttagtggcactctgcgacgttcgggcggcattgtttcggccatcgga
aagcagctgaaaagcatcaacctaaaaggcgtcaaacgcatcacagtccaatttgatccg
tttgcggaaaatgtcaagtctacccgcgaattcttcttcctgctctccacacccaaggtg
atccagacaaatcccaagtgcgtggtcaagtcggatattgtatgtgaccgtcaggcggct
tcgataaagtttgccctcattgattcggcgcaagaacaagctaaagtaaaggagatccgc
ttcaacagtggcaacctgaacaccctcgagttactggagctttgcaacaaacacgtctcc
agcttggccccacccgaggaggtgaccaacaaggtactgaccaaggcagagaaacagaag
ctgggcggcggcagcaagaaggcgttgaaaaagaaataa

DBGET integrated database retrieval system