KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17406
Entry
Dpse_GA17406      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K24242  cytosolic 5'-nucleotidase 3 [EC:3.1.3.5 3.1.3.-]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00230  Purine metabolism
dpo00240  Pyrimidine metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dpse_GA17406
   00240 Pyrimidine metabolism
    Dpse_GA17406
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Dpse_GA17406
    3.1.3.-  
     Dpse_GA17406
SSDB
Motif
Pfam: UMPH-1 HAD
Other DBs
NCBI-GeneID: 4805629
NCBI-ProteinID: XP_001362001
FlyBase: FBgn0077419
Position
3
AA seq 318 aa
MGCEEKQETTKPSLRIQDIPVLMQDHCRMLDPSKVERIINEFVQGGPERMQLVSDFDYTI
TKQRTEDGSVVPSSFGIFNACQSLPDSFKTESDKLYHKYRPIEIDPHMPIPEKVQYMVEW
WTKSGALATGFPFDQSEIDQIASKYKNALRDRTHEFFADLQRLGIPTLVFSAGLGNSVVS
LLRQANVMHPNVKVVSNFLQFRNGLLDGFQQPMIHTFNKNETVLDGSEYYNLVHTRDHII
VMGDSLGDADMASGVPASSHIIKIGFLFEHVEANMDKYMKTFDIVLVDDQTMDVPRALLA
LIEKQHQLKQQATTQSTL
NT seq 957 nt   +upstreamnt  +downstreamnt
atgggctgtgaggagaagcaagaaaccaccaagccaagcctgcgcatccaggacattccg
gtgctgatgcaggaccactgtcgcatgctagatccctccaaggtggagcgcatcatcaat
gagttcgtacagggcggcccggagcgcatgcaacttgtgtcggactttgactatacaatc
accaaacagcggactgaggacggcagtgtggtgccctccagttttgggatcttcaacgcc
tgccagtcgctgccggatagcttcaaaacggagtcggacaaactataccataagtacagg
ccaattgagatcgatccgcacatgcccatccccgagaaggttcagtacatggtcgaatgg
tggaccaagtctggtgcactggccaccggcttccccttcgatcaatcagaaatagatcag
attgccagcaagtataaaaacgcgctacgtgaccgtactcatgagttttttgccgatcta
cagcgcttgggcattcctacattggttttctccgccggactgggcaactctgtggtctcc
ttgttgcgccaggcaaatgtgatgcatcccaatgtaaaggtggtgtcgaatttcctgcaa
tttcgcaatggacttctggacggcttccagcagcccatgatacacaccttcaacaagaac
gaaactgtcctggacggcagtgagtattacaacctggtccacacacgcgaccacatcatc
gtgatgggggattccctaggagacgctgacatggcctccggcgttccggcctcttcgcat
atcataaaaattggtttccttttcgaacatgtggaggccaatatggataagtacatgaag
acatttgatatcgtcttggtggatgatcaaacaatggatgtgccccgggccttgctcgct
ctcatcgaaaagcagcaccagctaaagcagcaggccacaacgcagagcaccctttga

DBGET integrated database retrieval system