KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17779Help
Entry
Dpse_GA17779      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11793  cereblon
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dpo04121]
    Dpse_GA17779
Ubiquitin system [BR:dpo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     Dpse_GA17779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Yippee-Mis18
Motif
Other DBs
NCBI-GeneID: 4800775
NCBI-ProteinID: XP_001357990
FlyBase: FBgn0077788
UniProt: Q29B72
Position
2
AA seq 616 aa AA seqDB search
MDEEETAEINAQEQEVAGSAGEAAAGPSGAEVQPNDDSVAVERVIDVFEETAEMEAAMIE
RFFGPSGEVAEEGTLPVPGPSADGEGSANAGGERPSEEDIVLDDGTESDGSYNRPGSDMS
LDSPNSEDDSDVEAMPRWMIPQNRLRFAVDMMVSQARNQDGGIAALLNRDNFLQRVRSMV
FSQERRRSRNSDEVSPEAEDDELPEHPPPPPPRPPIDIDMEEGVHFDTNLPAEHSYFGPN
LNRVPGVNYQEVGSTHHMLIFLHQYILFPGEVLPFMIDGSLFDDDMSGLDGLIFAVAFPL
MKPPEDSKKLYGVTCQIYEKGDNGRHLTFYKSRALQRIVINCSDIKGLPQYIARNPTNKC
HSKVKILPEYFLPEPLKCIDMGSMSRFRDIPSMRDKYLRYQISSTPWPVEVCQEYAYEDI
VERARKKLEVHKIDTMPKCPIQMSFWLVRNLHLTEKMMSQMFLTDSVNLRLQLIGGILKE
ETLFYCRYCNSSLAYCSDLFAMSKHGVQTQYCNPGGYIHETNTVYRVISHAIGYSGEPST
RFSWFPGYQWHIILCKFCAQHVGWEFKAVEPNLAPKMFYGLAGSSVRIGKAGDSATVNGN
NFVVRNMLRVISEGME
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggaagagacagcagaaatcaatgcacaagagcaggaggttgctggctctgcg
ggggaggcagcggcaggcccgagtggggcagaagtgcaaccgaatgatgattccgttgca
gtagagagggtcatagatgtcttcgaggagacggccgaaatggaagcggccatgatcgaa
cgcttctttggaccgtccggcgaggttgcggaggagggcacgctcccagttcctggccca
tcggcagatggcgagggatccgccaatgccggaggtgaaagacccagtgaggaagacata
gttctggacgatggtaccgagagtgatggcagctacaaccgccctggcagcgacatgtcc
ttggatagtccaaacagtgaggatgactccgatgtggaggccatgccacgctggatgata
ccccaaaatcgattgcgtttcgccgtggacatgatggtgtcgcaggctcgaaatcaggac
ggaggaatcgctgcgcttttgaacagggacaacttcttgcagcgcgtccgcagtatggta
ttcagccaggagaggcgacggagtcgcaacagcgatgaagttagcccggaggctgaagat
gatgaattgccggagcatccgccgcctccgccaccgaggccacccatagatatcgacatg
gaggagggagtgcatttcgacaccaatctgccggcagaacattcgtattttggcccgaat
ttgaatcgagtgcccggcgtgaactaccaggaggtgggcagcacgcaccacatgcttatc
tttttgcaccagtacatcctatttcccggcgaggtgctgccctttatgatcgatggcagc
ctcttcgacgacgatatgtctggactggatggtctgatttttgccgtcgcttttcctttg
atgaagccacccgaggatagcaaaaaattgtatggagtgacctgccagatctatgagaag
ggcgacaacggacgccacctgaccttctacaagtcccgggccctccagcgcattgtcatt
aactgcagcgacatcaagggcctgccccagtacattgcacggaatccgaccaacaagtgc
cacagcaaggtgaagatactaccggagtactttctgcccgagcccctgaagtgcatcgac
atggggtcgatgagtcgcttccgggacataccctccatgcgggacaagtatctccgctat
cagatctccagcacaccgtggccggtcgaggtctgccaggagtacgcatacgaggatatt
gtggagcgggcgcgcaagaagctcgaggtacacaagatcgacacaatgccaaagtgtccc
atacagatgtcattctggctggtgcgcaatctccatctgaccgagaaaatgatgagccaa
atgttccttacggattcggtgaacctgcgcctgcaactcatcggcggtatcctaaaggag
gagacgctcttctattgccgctactgcaacagcagccttgcctactgctcagatctgttt
gccatgtccaagcatggcgtgcagacacagtactgcaatcctgggggctatatacacgag
acgaacactgtgtaccgggtgatatcccatgccattggctacagcggtgagccgtccacc
agatttagctggttccccggctaccagtggcacatcatcttgtgcaagttctgtgcccag
catgtcggctgggagttcaaggctgtcgagccgaatcttgcccccaagatgttctacggc
ctggctgggtccagtgtgcggattggcaaggcaggcgacagtgccaccgtaaacggcaac
aactttgtggtgcgcaacatgctgagggtcatttccgagggaatggaatga

DBGET integrated database retrieval system