KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17987
Entry
Dpse_GA17987      CDS       T01032                                 

Name
(RefSeq) uncharacterized protein
  KO
K06237  collagen type IV alpha
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dpse_GA17987
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpo04147]
    Dpse_GA17987
   00536 Glycosaminoglycan binding proteins [BR:dpo00536]
    Dpse_GA17987
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dpse_GA17987
Glycosaminoglycan binding proteins [BR:dpo00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   Dpse_GA17987
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 4816641
NCBI-ProteinID: XP_001355957
FlyBase: FBgn0077996
UniProt: A0A6I8W121
Position
4
AA seq 1784 aa
MMLPFWKRLLYAAVIAGALVGANAQFWKTAGTSGSIQDSVRHQSREDPRDSFPIDDSYDI
VDSASIQRGGQPPKNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGPKGVSGFPGQDGPLGD
KGQKGDPGPYGLRGDKGERGSQGIPGLPGVGGVQGSSGNPGLPGINGKDGCDGSDGLPGL
QGLSGMAGPRGFPGSPGGKGEKGEPAKENGNYAKGEKGEPGFTGRSGYAGPQGNPGDKGE
RGDTGPYGSKGLRGDRGIKGEKGDSCFGPLMPGKQGEKGEKGDPAVPIPVTGSERVSGPR
GDPGQKGEVGPYGEKGELGPGGEPGQDGQKGEKGLPGGSGDRGRQGNFGPPGPSGQKGDR
GETGLNGLPGSFGQKGEPGRPGQSGQRGLVGPPGPPGGGRGQPGAPGPKGPRGYTGTPGP
QGLNGADGQPGPQGYVGQKGGSGMPGRPGGEGPPGQKGEKGIGGRVGPQGPVGPIGHTGP
PGPEGQKGDAGTPGYGIEGPKGDDGNPGYPGQKGGKGERGFKGNSGVPGDSKLGRPGTPG
NAGAPGQKGDAGRPGTPGAKGDMGIKGDIGGKCSSCPPGLKGDKGTRGLDGIPGNPGVRG
PPGEPGHQGERGHDGINGQTGAPGEKGEDGLTGAPGATGAPGKGAIINYSQIKTEKGEKG
QPGLPGAAGVKGDRGESGVPGLAGVKGEMGFKGDKGYTGQAGTDGIPGAPGRDGYDGAPG
LSIKGESGSRGMDGLKGDKGTAGYVGPKGEPGTCEASELKIPAKGNKGDRGATGMPGVDG
PIGQKGEIGYRGEKGSTGPQGPVGPVGPRGMTGPRGEKGNIGPIGAAGNPGKDGTRGLPG
RNGDRGQKGEEGIPMPGPPGPQGREGLQGLKGTRGLPGPQGLPGQEGNAGYPGDKGDAGV
PGIPGRVGAVGEKGDLGPLGPIGQPGPPGIPGIDGVQGRDGSKGEPGNPGLVGMPGNKGD
RGAPGNDGPKGFNGITGSPGKRGPAGIPGISGMKGDKGARGLTGNDGPMGGRGPPGPPGL
LGVKGEPGLLGAPGQRGLDGLNGEKGNQGLPGYDGPQGLPGDASEKGQKGEPGLSGLRGD
PGVSGEPGLPGEKGLPGMAVYGRPGPQGEKGDTGRSGADGINGLNGEKGDIGLPGLSGRN
GEKGSVGLPGLPGAPGIDGQPGLQGAPGPVGYPGAQGYKGQAGLPGLSGIKGDTGPIGPQ
GYIGNAGIKGERGPRGQPGLPATVNVDMLRGEKGSVGERGLTGEKGDQGERGEQGLAGYP
GVKGDQGLEGPRGLNGLNGAPGLKGDAGLVGEPGYPGPVVKGEKGLPGRAGKYGREGLPG
APGIKGERGLPGLAGTPGLVGLPGPIGPAGDKGERGLAGTPGQPGLDGLSGAPGLKGDQG
YPGPKGDRGLAGFEGQKGDKGDQGHAGLPGLAGLAGAKGDTGYPGLDGPEGPQGSPGEKG
FTGPKGRDGRDGIPGLQGQKGEPGMVPPPGPKGEPGKPGREGQKGEPGQPGARGLTGIQG
QRGEKGDRGLIGPSGAIGRPGPKGDRGEQGQVGREGAVGAMGLKGDAGLACSGAQDYLTG
ILVTRHSQNDQVPQCAAGHSQLWTGYSLLYVDGNDYAHNQDLGSPGSCVQRFSTLPVLSC
GQNNICNYASRNDKTFWLSTSAPIPMMPVENYEISKYISRCVVCEAPANVIAMHSQSLEI
PECPSGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYE
TMTSFWMVTLESNDQFEKPQQQTIKSGNLLSRVSRCQVCMKNSS
NT seq 5355 nt   +upstreamnt  +downstreamnt
atgatgttgcccttctggaagcggctgctgtacgccgctgtcatcgctggagcgttggtt
ggtgcaaacgctcaattctggaagaccgctggcacctctggttctattcaggactcagtc
agacaccaaagcagagaagacccccgggactcatttcccattgatgatagctatgacatt
gtagactcggcgtcaattcagcgcggcggacagccacccaaaaactgtacagccggatac
gccggctgtgtgcccaaatgcattgccgagaagggtaaccgcggtctgccaggtccattg
ggtcccaccggacccaagggtgtctcgggctttccgggtcaggacggaccactgggcgac
aaaggccagaagggtgaccccggaccatatggactgcgcggcgacaagggcgagcgtgga
tcgcagggcattcccggtctgccaggcgtaggaggtgttcagggatcgtctggcaatccc
ggcttacccggtatcaacggcaaggatggctgtgatggatccgatggtttgcccggcttg
cagggtctctcgggtatggcaggaccacgtggcttcccgggcagtccgggtggcaagggt
gagaaaggtgaaccggcaaaggagaacggaaactacgcaaagggcgagaaaggtgagccc
ggcttcacaggacgttcagggtacgcaggaccccaaggcaatcctggtgacaaaggcgaa
cgtggtgacaccggaccgtatggctccaaaggtctgcgtggagatcgtggcattaaggga
gagaaaggcgactcttgctttggacctctgatgccaggaaagcagggagagaagggcgag
aagggtgatccagccgttcctatccccgtcactggtagtgaacgtgtgtctggcccacgt
ggtgatcccggacagaagggagaggttggaccctatggcgagaaaggtgagctcggtcct
ggcggtgagcctggacaggatgggcagaagggcgagaagggcttacccggcggctctgga
gatagaggtcgtcaaggtaactttggaccaccaggaccttctggacagaagggagaccgt
ggtgaaactggtctaaacggcttgcctggaagtttcggtcagaagggagagccaggacgt
cctggtcaatccggtcagcgaggtttggtcggtcctccaggaccaccaggtggcggtcgc
ggacagccaggtgctccaggaccgaaaggaccacgtggttatactggcacgcccggtccc
cagggcctgaacggcgctgatggacagccaggaccccagggatacgttggccagaaggga
ggtagtggcatgcccggccgtccgggtggcgaggggcctccgggacaaaagggtgagaaa
ggtattggaggacgcgtcggaccccagggccccgtcggacccatcggccacactggacct
ccaggccccgaaggtcaaaagggcgatgccggcacccctggctatggcattgaaggtccg
aaaggagacgatggaaatcctggctatcctggccagaagggcggaaagggcgaacgaggt
ttcaaaggaaattctggtgttcctggcgattcgaaattgggcagacctggcacgcccggc
aacgctggtgctcccggacagaagggtgacgctggccgtcccggtactcctggcgctaag
ggagacatgggcattaagggagacattggcggcaagtgttcctcttgcccacccggtctg
aagggagataagggtacgcgaggtttagatggtattcccggcaatcccggcgttcgagga
ccacctggagagcctggacaccaaggcgaacgaggccacgatggaatcaacggacagacg
ggtgctccaggagaaaagggagaggatggtttgactggtgcccctggtgccactggagct
cctggtaagggagcaattatcaactatagccaaataaagaccgaaaagggagaaaaggga
cagccaggccttcccggagctgcgggtgtaaagggagaccgcggagaaagcggcgttcct
ggtcttgctggagtcaagggagaaatgggctttaaaggagacaaaggctacaccggacaa
gctggcacagatggtatccctggagccccagggcgcgatggatacgatggtgctcccggt
ctcagcattaagggagaatcaggcagtcgcggcatggacggtcttaagggtgacaagggt
acagccggatacgtcggaccgaagggagaacccggcacatgcgaggccagcgagctgaag
atcccagcaaagggaaataagggcgaccgtggtgccactgggatgcccggagtcgatgga
ccaatcggacagaaaggcgagatcggataccgcggtgagaagggttcaaccggtcctcaa
ggcccagttggtcccgttggcccccgtggaatgactggaccccgtggcgagaaaggtaac
atcggacccatcggtgctgctggcaatcctggaaaagacggtactcgtggcttgcctggt
cgtaacggagatcgcggtcaaaagggagaagagggaataccgatgcctggaccacccggc
ccacagggtcgcgaaggcttgcaaggtctaaaaggaactcgtggcctacccggaccccag
ggtctgcctggacaagaaggaaacgctggctatcccggtgataagggagatgctggagta
ccaggaatacctggtcgtgttggcgctgttggcgagaagggagacctcggcccattgggt
ccaattggacagcccggaccccctggtattcctggtattgatggagtgcaaggccgcgac
ggatccaagggtgaacctggtaatcctggtttggttggtatgcccggcaataagggcgat
cgcggagcacctggcaacgacggacctaaaggctttaacggaatcaccggctcacccgga
aagcgtggaccagctggaattcccggaatttcaggcatgaagggcgacaaaggagctcgt
ggcttgactggaaacgacggaccgatgggtggacgaggacccccgggaccacctggcctg
ctgggtgttaagggtgagcccggacttctcggtgccccgggacagagaggactggacggc
ttgaatggtgaaaagggtaaccaaggtctgcctggctatgacggacctcagggcctgcct
ggagatgcttccgaaaagggacagaagggtgaacccggtctgtctggactgcgcggtgat
cctggagtatccggtgagcctggactgcctggagaaaagggattgcccggtatggctgta
tacggacgacctggaccccaaggagaaaagggtgacactggacgtagtggcgcggacggc
ataaatggattaaatggagaaaagggtgacattggcttgcctggcttatctggaaggaat
ggcgaaaaaggatccgttggacttcctggccttcccggagctcccggaattgatggtcag
cctggactgcagggtgctcccggaccagtcggctatcccggcgcccaaggatacaaggga
caggctggcctgcccggtctgtccggcatcaagggtgacactggccccattggtcctcag
ggctacattggaaacgctggcatcaagggcgagagaggtccacgtggtcagcctggcctc
ccagctactgtcaatgtcgatatgctccgaggcgagaaaggctctgtgggagagcgcggc
ctgaccggagaaaagggagatcagggagagagaggagagcaaggtctggctggatatcca
ggagtaaagggagaccagggactggaaggtccccgtggcttgaatggactgaacggagcc
cctggactgaagggagatgcgggtcttgtaggtgagcctggttaccctggacccgttgtc
aagggtgagaagggtctgcccgggcgcgccggaaagtacggacgtgaaggccttcccgga
gcacctggcatcaagggcgagcgtggtttgcctggcctggccggtacacctggcttagta
ggtctgcccggacccattggacccgcaggcgacaagggagagcgtggtctggctggtaca
cctggtcagcccggactcgacggattaagtggcgctccaggtcttaagggcgaccaaggc
tatcccggaccgaagggagatcgtggattggctggctttgaaggacagaagggtgataag
ggtgaccagggacacgccggcctgcccggtctggctggattagctggtgccaagggtgac
actggataccccggcttagacggaccagaaggaccacagggctccccaggtgagaagggc
ttcaccggacccaagggacgcgacggccgcgacggaattccaggtctgcaaggacaaaag
ggtgaacccggcatggtgccgccgccaggacccaagggcgaacctggcaagcctgggcgt
gaaggtcaaaagggcgaaccaggccagcccggtgcccgtggcctgaccggaatccaagga
cagcgtggagaaaagggtgatcgcggtctgatcggtccaagcggagctatcggacgtccc
ggacccaagggcgaccgtggagagcaaggtcaggttggacgagagggtgccgtcggcgcc
atgggtctgaagggtgatgcaggtctagcctgtagtggcgcccaggactacctcaccggc
attcttgtgacacgccacagtcagaacgaccaagtgccgcaatgcgctgcgggtcactcg
cagctctggactggctattctctactctacgtggatggcaatgactacgcccacaaccaa
gatctcgggtccccgggctcctgtgtgcaacgcttctccactttaccggtactgtcctgt
ggacagaacaatatctgcaactacgcgtcgcgcaacgataagaccttctggctgtcaaca
tcggcccccattcccatgatgccggtggagaactacgagattagcaaatacatctcgcgc
tgtgtggtctgcgaggcgcctgccaacgtcattgccatgcacagccagtctcttgaaata
cccgaatgcccctcaggttgggagggtctctggattggctacagtttcctcatgcacacg
gccgtgggcaatggaggcggtggccaggctctgcaatcgcctggctcatgcctagaggac
ttccgtgcaacaccgttcatcgagtgcaacggcgccaagggcacctgtcacttctacgag
acaatgaccagcttctggatggtcactctggagtcaaacgaccagtttgagaagccccag
cagcagacgatcaagtccggcaacctgctgtcccgcgtctccaggtgtcaagtctgtatg
aagaactcgtcatag

DBGET integrated database retrieval system