KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18478Help
Entry
Dpse_GA18478      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00062  Fatty acid elongation
dpo01100  Metabolic pathways
dpo01212  Fatty acid metabolism
dpo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    Dpse_GA18478
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dpse_GA18478
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dpse_GA18478
Lipid biosynthesis proteins [BR:dpo01004]
 Fatty acid synthase
  Component type
   Dpse_GA18478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2 Abhydrolase_1 PGAP1 Abhydrolase_6 FSH1 DUF2974 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 4817466
NCBI-ProteinID: XP_001356802
FlyBase: FBgn0078480
UniProt: Q29M27
Position
4
AA seq 282 aa AA seqDB search
MRLRLLLAVFVCFADAYRPVVILHGILSGADSMDFLVREIEELHRGTIVYNCDKFSGWYS
LENAWRQVEQIRDYLSDVGKKHPEGINVLGYSQGGLLARAAIQSLPDHNVKTFISLSSPQ
AGQYGTSFLHLIFPDLAAKTAFELFYTTVGQHTSVGGYWNDPHKQSLYLKYSEFLPLINN
EKQSSNSTSFKMGMVRLSKLVMVGGPNDDVITPWQSSHFAYYDEDLDVIPFNKRKLFTDD
LIGTRTLQEAGKLIIIVKPHVHHLAWHTNRAVIHQVILPYLD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaggctaaggctcttgctggctgtgttcgtctgctttgctgatgcatacaggccggtt
gtgatactccatggaatcctgtcgggcgcggattcaatggactttttggtgcgggaaatc
gaagagctccatcggggcacaatcgtctacaactgcgacaaattcagcgggtggtacagc
ctggagaatgcctggcggcaggtcgagcagattcgggattatttgagcgatgttggtaaa
aagcacccggaaggaatcaatgtgttgggctactcccagggcggactcttggcccgtgcg
gccatccaaagtctgcccgatcacaatgtaaagaccttcatttccctatcttcgcctcaa
gcgggtcaatacggaactagcttcctgcatttgatatttccggatctggcggcgaagacc
gcttttgagctattctacacaacggtagggcagcacacatcggtgggcgggtactggaac
gacccgcataaacagtcactgtatttgaaatacagcgagttcctgccgctgatcaacaat
gagaagcagtcctccaactccacctccttcaaaatgggcatggtgcgtctcagcaagctg
gtcatggtcggcggccccaacgacgatgtgataacgccctggcaatccagccactttgcc
tactacgacgaggacttggacgtgattccgttcaacaagcggaagctcttcactgacgac
ttgatcggcactaggacgctccaagaggccgggaaacttatcatcatagtcaaaccccat
gtccatcatttggcatggcacacaaacagagccgtaatacatcaagttatcttgccatac
ctggactga

DBGET integrated database retrieval system