KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19009
Entry
Dpse_GA19009      CDS       T01032                                 

Name
(RefSeq) uncharacterized protein
  KO
K18966  sulfinoalanine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.29 4.1.1.11]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00410  beta-Alanine metabolism
dpo00430  Taurine and hypotaurine metabolism
dpo00770  Pantothenate and CoA biosynthesis
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dpse_GA19009
   00430 Taurine and hypotaurine metabolism
    Dpse_GA19009
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Dpse_GA19009
Enzymes [BR:dpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     Dpse_GA19009
    4.1.1.29  sulfinoalanine decarboxylase
     Dpse_GA19009
SSDB
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Other DBs
NCBI-GeneID: 4813763
NCBI-ProteinID: XP_001353322
FlyBase: FBgn0079007
UniProt: Q2M0V1 A0A6I8UCH5
Position
XR
AA seq 506 aa
MDQALAVNRVREGLMDDWSILENVFKLLQKDDTFCVDPQKWNKQKIVSFLQPDDLKELIN
LKIRETETSTLAEIEQLCQSVIQYSVKTSHGRFHNQLFGQVDPFGLAGALITEAMNGSSY
TYEVAPVFSLIETELIATVCRLAGYDHGDGIFGPGGSMSNMYGIVMARYKYAPEVKTTGM
FGMRPLVLFTSDESHYSFVKASHWLGIGSDNCVAVRTNERGQMLLDDLEAKIIESKARGA
QPFFVNCTAGTTVLGAFDDINGAADLAERHGLWLHVDACLGGAALLSHKHRSLIAGLQRA
NSFAWNPHKTVGVPLQCSLFLTRESGNLLERCNSAEAHYLFHQDKFYDVSYDTGNKSVQC
GRKIDAFKFWLMLKARGYGQYGHLVDHAIDMGRLLENKLRERPDRFRLVLQKHEYSNVCF
WYIPKDMRVPANEETTDWWTRLYTVAPKIKEQMAYSGTLMVGYSPLKAQNLGNFFRMVFT
CFPVLQIHELDFILDEIERLGEKIVA
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggatcaggcattggctgtgaatcgagttcgcgaagggcttatggatgattggagtatc
ctggaaaatgtattcaagctactgcagaaggacgacacattctgtgtggacccccaaaaa
tggaataagcagaaaatcgtatcatttttgcagccagacgatttgaaggaattgattaat
ctgaaaatccgggagacggagacgtccactctcgcggaaatcgagcagctttgccagtcg
gtgatccagtattcagtcaagacctcgcatggacgcttccacaatcaactgttcggacag
gttgacccctttggattggcgggagcattgatcacagaggccatgaatggaagctcatac
acctatgaagtggcgcctgtgtttagtctgattgaaacagagctgattgctacggtctgt
aggttggccggctatgaccatggtgatggtatttttggtcctggaggatccatgtccaac
atgtacggcatcgtgatggctcgctacaagtatgctccagaggtgaagaccactggtatg
ttcggaatgcggcctctggtgttgtttacctccgacgagtcccactacagttttgtgaag
gcctcccactggctgggtatcggcagtgacaattgtgtggctgtaagaaccaacgaacgc
ggtcaaatgcttttggacgacctagaggcaaagataatcgagtcaaaggctcgtggggca
cagcctttctttgtcaactgtacagccggaaccactgtgctgggcgcattcgatgatatc
aacggtgctgcagatctggcagagcgccacggactgtggcttcacgtagatgcgtgcctt
ggcggcgcagcgctcttatcccacaagcatcgatctttgatagccggtctccagcgtgcg
aactcctttgcctggaatccccacaagacggttggagttccactccagtgctcgttgttc
ctcacgcgggagtcgggaaatttgctggaacgctgcaacagtgcggaggcccactatctg
tttcatcaggacaagttctacgacgtctcctacgatacgggcaacaagagtgtgcagtgc
ggccgcaagatagatgccttcaagttttggctaatgctcaaggctcgtggctacggacag
tatggacacttggttgaccacgccatcgacatgggcagattattggagaacaaacttcgt
gagcgtcccgatcgtttcagactcgtactccagaagcatgagtactccaatgtctgcttc
tggtacatacccaaggacatgcgggtaccagccaacgaagagacgactgattggtggact
cgtttatacacagtagcccccaaaattaaggagcagatggcgtacagcggcacgttgatg
gtaggatattccccgctaaaagctcaaaatttgggtaacttcttccggatggtcttcacg
tgctttcccgttcttcaaattcatgagctggattttatcttggacgagattgaacgactg
ggcgagaaaatcgtagcttaa

DBGET integrated database retrieval system