KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19011Help
Entry
Dpse_GA19011      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    Dpse_GA19011
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dpse_GA19011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC UPF0182
Motif
Other DBs
NCBI-GeneID: 4813857
NCBI-ProteinID: XP_001353360
FlyBase: FBgn0079009
UniProt: Q2M0R3
Position
XR
AA seq 734 aa AA seqDB search
MNLLCCCCCSNMAPNQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALF
FAFDCPFLAERINPVIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVP
NSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWV
GNCVGKRNYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMKTEQEVFEVIKKAPFTVIVVFI
CFFSIWSVIGLAGFHTYLTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHILCG
PMTPSMIDRRGFATDEYIQQMQHQSSPRHALSDVLSASHMVTTAQPMLGGPGGGIGGAGG
GISIGGAELKPRFYDESNPSSSTMDGSGAAASAALNGHGLGHGHGHGHGHGHGNGNGNGF
EHPPPSYDLVQNGNSNSLAQLVDNEIPLAQMDIPAYTQQTATQARQFRHRHHKQRQLSNG
ASVSYENQLATASSEDELDDAEVVVVGSPEVVAAVAAIATNKARGLRNRSGSYSNLFDAD
FEAALVNSALAEGQAGAEAAGGTATGSTDVFKPSAGAALLAVAMGGDHALASSASKTENM
YSNVPHVASASNAAPPDAALHVYSNIIDERAQQHQREQLQATTVLSSTLLSDDLDLDDPV
SASFVAAHSQRKSIGDGAEQAKSADRLRMLHDTTMIDTALDLDSLDGSSMGNNSQSCLVK
SNKPTASGSNVNIV
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgctctgctgctgctgttgcagtaacatggcacccaaccagcgcgtcacacgc
aaatgggaactgtttgccggacgcaataaattctactgcgatggattgctaatgtccgca
ccgcacacgggcgtcttctacttgacgtgcatcctgataaccggcaccagtgcgctcttc
tttgcgttcgactgcccgttcctggcggagcgcatcaacccagtcattcccattgtgggc
gccgtcctctacttcttcacgatgagctccctgctgcgcacaaccttcacggacccgggc
gtcataccgcgtgcctccaacgacgaggcggcctatattgaaaagcaaattgaggtgcca
aactcgctgaacagccccacgtaccggccgccgccgcgcaccaaggaggtgctcgtcaag
ggccagacggtcaagctgaagtactgcttcacctgcaagatcttccggccaccgcgggcc
tcccactgcagcctgtgcgacaactgtgtggaccgcttcgatcaccactgtccctgggtg
ggaaactgcgtgggaaagcggaactatcggttcttttatttgtttctagtctcattggca
tttttagctgtatttatattctcgtgctctgtgacgcatttagttttattgatgaaaacc
gagcaagaggtcttcgaagtaataaagaaggcgcccttcactgtgattgttgtgttcatt
tgcttcttttcgatatggtccgtcatcggactggccggattccacacctatctgacgacg
agcgaccagacgaccaatgaggatctcaagggatccttctcatcgaagggcgggccgcgc
acccagaacccctactcgcggggcaacatctgtctcaattgttgccacatcctatgcgga
cccatgacgccctcgatgattgacaggcgcggctttgccaccgacgagtacatccagcag
atgcagcatcagtccagtccccggcacgccctcagcgatgtcctgagcgcctcccatatg
gtcaccaccgcgcagcccatgctgggcggcccgggcggtggcattgggggggcgggcggc
ggcatcagcatagggggggcggagctgaagccccgcttctacgacgagtcgaatccctcc
tcctcaacaatggacggatcaggggccgccgcatcagccgccctcaacggccacggcctc
ggccatggacatggacacggacatggccatggccatggcaatggcaacgggaacggcttc
gaacacccgccgcccagctacgacctggtccagaacggtaattccaatagtctagctcag
ctggtggacaacgagattcccctagcccagatggacattccggcgtacacgcagcagacg
gccacccaggcgcgccagttccgccaccggcaccacaagcagcggcagctctcgaacgga
gcctcggtcagctacgagaatcagctggccaccgccagcagtgaggacgagctggacgac
gccgaggttgtggtcgtcggcagtccggaggtggtggctgcagtggctgccattgccacc
aataaggcgcggggtctgcggaaccgcagcggtagctacagcaatctcttcgacgcggac
tttgaggcggcactggtcaactctgccctggctgaagggcaggcaggcgcggaggcagct
ggtggcacggcaacgggctccaccgatgtcttcaagccctcggctggtgctgcattgttg
gctgtcgccatgggcggtgaccatgcgctggccagctcggcctccaagacggagaacatg
tacagcaatgtgccgcacgtggcgagtgcctccaacgcagcgcccccagacgccgccctg
cacgtctactcgaacattatagacgagcgggcccagcagcatcagcgagagcagcttcag
gccaccacagtgctgtcctcgacgctcttgagcgacgacctcgatctggacgatccagtg
agtgcctcctttgtggccgctcactcgcagcgcaagtcgatcggcgacggggcggagcag
gccaagtcagcagatcggctgcgcatgcttcacgacaccacgatgatagacacggcgctg
gacctggacagtctcgacggctccagcatgggcaacaactcgcagtcttgcctggtgaag
tcgaacaagccgacagccagtggttccaacgtgaacatagtctga

DBGET integrated database retrieval system