KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19537
Entry
Dpse_GA19537      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Dpse_GA19537
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dpo03400]
    Dpse_GA19537
DNA repair and recombination proteins [BR:dpo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     Dpse_GA19537
SSDB
Motif
Pfam: XPA_C XPA_N
Other DBs
NCBI-GeneID: 4814435
NCBI-ProteinID: XP_001354510
FlyBase: FBgn0079533
UniProt: A0A6I8UF59 Q29I43
Position
XL
AA seq 289 aa
MSEETAAVVVAPSTLTTAQKSRIERNLAKAQKLREAKLVSHPYRELGKNGDTQLEEGPSQ
GTSVIKVQGTKYIDSGGGFLLEQPVLPAAGAGVTERPEDGAVPTIVDDAIAIPVVYEECL
DCGDPFVDSYLFNNFGHSVCDKCRDTEERHSLITRTEAKAEYLLKDCDFDKREPPLRYIS
RKNPHNVRWGEMKLYLHSQVQKRAMEVWGSEEELVRQHEGREEKREVGKARKYNKQMKQL
RMEVRSSIYTKKTHAIHEHEFGPDTYNEEEDEYTHTCLTCPYTESYEKM
NT seq 870 nt   +upstreamnt  +downstreamnt
atgtcagaggaaacagccgcagtggtggtagccccctccactcttaccacagcccagaag
tcacgcattgagcgcaatctggccaaggcccagaagttgcgagaggccaaactcgtctcg
catccttatagggaactcggcaaaaacggcgatactcaactagaggaagggccgagtcag
ggcacctcggttatcaaggtgcagggcaccaaatacatcgacagtggcggaggcttcctg
ctggagcagcctgtgttgcccgcggctggagcgggagttacagaaaggccagaggatggc
gcagttccaactatcgtggacgatgccattgctataccggtggtgtacgaggagtgcctc
gattgcggcgatccgtttgtcgactcatatctgtttaataattttggacactcggtgtgc
gacaagtgccgggacaccgaggagcgccactcgctcatcacccgcactgaagccaaggcc
gagtatcttctgaaagattgtgactttgacaagcgcgaaccgccgttgcgctacattagc
cgcaagaatccccataatgttcgctggggagagatgaagctctacctgcactcgcaggtg
caaaaacgggccatggaggtgtggggcagtgaggaggagctcgtccgtcaacacgaggga
cgggaagagaaacgtgaggtaggaaaggcccggaagtacaacaaacagatgaagcagctc
cgcatggaggtccgcagcagcatttacaccaagaaaacgcatgccatacacgagcacgaa
ttcgggccggacacctacaatgaggaagaagacgagtatacgcacacctgcctcacctgt
ccctacaccgaatcctacgagaagatgtag

DBGET integrated database retrieval system