KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19543
Entry
Dpse_GA19543      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein, isoform A
  KO
K20677  serine protease Hayan [EC:3.4.21.-]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpo01002]
    Dpse_GA19543
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     Dpse_GA19543
Peptidases and inhibitors [BR:dpo01002]
 Serine peptidases
  Family S1: chymotrypsin family
   Dpse_GA19543
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 4814421
NCBI-ProteinID: XP_001354361
FlyBase: FBgn0079539
UniProt: A0A6I8UEU2 Q29G15
Position
XL
AA seq 622 aa
MSRRQVGLLLAVLFLLDSCGLNTASEEGEECMVKENLPGICRPSSACEPFVDGYIKSGIL
SINDVPSCGLGPREEIICCPTKPCCPNDPSSKGTATAPATPPAPSPAPAPAPAPSPAPPP
VTIPELSRESRLDQGDSFFDFNQILSTPRSVPQPTGKGGRTHDAIRMQPEPFQSIGQWGV
APPSTTTTPRSVPPWGWTDGTPRIVNKPLTIRDPNPRAQQHMQQGNRRPGNNLIHVVNER
LRQQGMTIEPAREVGSLSLLTPVTPVHLVTPVTPTKKVLVDPFAPFRFQAKEQKGYVVPS
DASMFPFRIPETTSTARPPVSATPISRVDVPTESNEGQERPSVVACRRIQSRYGENRLTV
HILEGIPVNPGVYPHMVAIAYSTFGGSPEYRCGGSLISSRFVLTAAHCVNSMENTPIFVR
LGTVNIESPPPQYKDIGLKNIIIHPNYVSSSKYNDIALMELAEEVNFANNSNIYPACLHT
DTKDPPLSSKLFVAGWGTMNLTNRSRSKVLLRAPLDLVPLDKCNQLFSEQPSTIRALKQG
VIDSMMCAADLKELKADACAGDSGGPLILDINVEDGLYSIVGIISAGFGCATKTPGLYTR
VASYLDFIEGIVWPDKVLGAGI
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgtctagacgtcaggtcggcctgctgttagcggtccttttcctcctcgatagctgtggt
ctaaacacagcaagcgaggaaggcgaagaatgcatggtgaaggagaacttgccgggcatc
tgccgcccctcgtccgcttgcgagcccttcgtcgacgggtacatcaagtcgggaatcctc
tccatcaacgatgtccccagctgcggcctcgggccgcgcgaggagattatatgctgcccc
acgaagccctgctgccccaatgacccaagctcgaaaggaacagcaacagctccagcaact
cctcctgcaccatcacctgctcctgctcctgctcctgcaccgtcacctgcacccccacct
gtcacgataccagaactgagccgggaaagtagactggatcagggcgacagcttcttcgac
ttcaatcagatcctaagcacgccgcggagcgtgccacagcccacaggaaagggcggcagg
acccacgatgctattcgaatgcagccagagccattccagagcatcggtcagtggggcgtt
gctcctccctctacgacgactacgccaagatctgtgcccccttgggggtggactgatgga
acacccagaatagtaaacaagcccctgacgatccgcgatccaaacccaagagcacagcag
cacatgcagcagggtaaccggcgacccggcaataatttgatacacgtggtcaacgaaagg
ctccgtcagcagggaatgacgatagagcccgccagggaggtggggtcgctgtcgctcctg
acgccggtgactccggtgcacctggtgaccccagtgacgccgacgaagaaggtgctggta
gacccctttgctccgtttcggttccaggcgaaagaacaaaagggatacgtcgttccatcg
gatgcctcgatgttcccgttccgaattccggagacaacgtccacggcccgaccacccgtc
tcggccacccctatatcgcgtgtggatgtgcccactgagagcaacgaggggcaggaacgg
ccatcggtggtggcttgcaggaggattcagagccgatacggggagaacaggctgacggtg
cacatcctggaggggattcccgttaatcccggcgtctatcctcatatggtggctatcgcg
tacagcaccttcggtggatctccggagtaccgttgtggcggctccttgatctcgagtcgg
ttcgtcctcaccgctgcccactgcgtcaacagcatggaaaacacgcccatatttgtgcgc
cttggcactgtgaacatcgagagtcctccaccgcaatataaggacataggcttgaaaaat
attatcatccatccaaactacgttagcagcagcaagtacaacgacatcgccctcatggag
ctggcggaggaggttaacttcgccaacaacagcaacatatatccggcgtgcctgcacact
gataccaaggatccgccactcagctccaagctctttgtggccggctggggaaccatgaac
ttgaccaatcgctccaggtccaaggtcctcctgcgcgccccacttgacctggtgccgctg
gacaagtgcaatcagttgttttccgaacagccaagcaccatccgtgccctgaagcagggt
gtgatcgactcgatgatgtgcgcggctgacctcaaggagctgaaggcggatgcctgcgct
ggcgactccggtggcccgctcatcttggacatcaatgtggaggacggcctgtactccata
gtgggcataatttcggctgggtttgggtgcgccaccaagacgccgggcctgtacactcga
gtggcctcctacttggacttcatcgagggcattgtctggccggacaaggttctgggagcg
gggatatga

DBGET integrated database retrieval system