KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19618Help
Entry
Dpse_GA19618      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20752  hypodermin C [EC:3.4.21.49]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.49  hypodermin C
     Dpse_GA19618
Peptidases [BR:dpo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dpse_GA19618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 5495512
NCBI-ProteinID: XP_001353851
FlyBase: FBgn0079614
UniProt: Q2LZC1
Position
XR
AA seq 274 aa AA seqDB search
MKFLIILALAIASASAFPEPELVSRNRVMPVQDSIEGRITGGSAATTGQFPYQVGLSLKL
SALSSAWCGGSLIGNQWVLTAAHCTDGVQSVTVYLGATVRTSAEVTHTVASSQILIHSGW
NSANLRNDISLIKIPVTSYSTKIQAARIPAIASSYSTYAGDSVIASGWGKISDSATGVTN
NLQWAKLTVITNSVCANTYGTSIVTASNICVSTPNGVSTCNGDSGGPLVLESSKVQVGLT
SFGAAAGCQKGYPAAFTRLTSYLDWIKTNTGISY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctgatcattctggctttggcgatcgcctccgcttcggctttccccgagccc
gagctggtgtcccgcaaccgcgtgatgcccgtccaggatagcatcgagggtcgcattacc
ggaggatccgctgccaccaccggccagttcccctaccaggtgggactatccctcaagctg
agcgctctctccagcgcctggtgcggtggctctttgatcggcaaccagtgggtgctcact
gctgctcactgcaccgacggtgtccagtccgtgactgtctacctgggtgccaccgttcgt
acctccgctgaggtcacccacaccgtcgccagctcccagatcctcatccactccggctgg
aacagcgccaacctgcgcaacgacatctctctgatcaagatccccgtcacctcgtacagc
accaagatccaggccgccaggatcccagccatcgccagctcctactccacttacgccggt
gactccgtgatcgcctccggctggggcaagatttccgactccgctaccggtgtgaccaac
aacctgcagtgggccaagctgactgtcatcaccaattccgtgtgcgccaacacctacgga
acctccattgttaccgcctccaacatctgtgtgtccacccccaacggtgtgtccacctgc
aacggcgactccggcggccctctggtgctcgagtcctccaaggtccaggttggtcttacc
tccttcggcgctgctgccggctgccagaagggctaccccgctgccttcactcgcctgacc
agctacttggactggatcaagaccaacactggcatctcctactaa

DBGET integrated database retrieval system