KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19741
Entry
Dpse_GA19741      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00040  Pentose and glucuronate interconversions
dpo00053  Ascorbate and aldarate metabolism
dpo00830  Retinol metabolism
dpo00860  Porphyrin metabolism
dpo00980  Metabolism of xenobiotics by cytochrome P450
dpo00982  Drug metabolism - cytochrome P450
dpo00983  Drug metabolism - other enzymes
dpo01100  Metabolic pathways
dpo01240  Biosynthesis of cofactors
Module
dpo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA19741
   00053 Ascorbate and aldarate metabolism
    Dpse_GA19741
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dpse_GA19741
   00860 Porphyrin metabolism
    Dpse_GA19741
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dpse_GA19741
   00982 Drug metabolism - cytochrome P450
    Dpse_GA19741
   00983 Drug metabolism - other enzymes
    Dpse_GA19741
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dpo01003]
    Dpse_GA19741
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dpse_GA19741
Glycosyltransferases [BR:dpo01003]
 Others
  Hydrophobic molecule
   Dpse_GA19741
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 Glyco_trans_4_2 Glyco_transf_4 DUF5601
Other DBs
NCBI-GeneID: 4803126
NCBI-ProteinID: XP_001359920
FlyBase: FBgn0079737
UniProt: A0A6I8US38
Position
2:complement(28469937..28471824)
AA seq 562 aa
MMERLFSPIEQSFFSYQLKAYDYTYIVGTFREVHSISLYLRSAMRILFVFIGSILLALGG
LPLPAEGAKILATLAWPGRSQYIFVENYLKGLAARGHEVTVINTFKNKATPNMRFIEALK
VQEFHQQMLAELEASTLWQELNAISGLEEKVAAFTLDDEGVQKLMKSGETFDVVLAEMIE
VPALYGMAQHFNATLVGFSSYGSDYRIDSQLGNTSPLSYNPSIMSPRTDRMSFCERLTNH
YEYLVEMLHRQLVHLPAMERMYNKYYPNARQTMDEVLDSFALVLLGQHFSLSYPRPFLPN
MIEVGGLHIAHKPQPLPEDIKAFIEGAEHGVIYFSMGSNVKSKDLPQETRDTLLKTFGKL
KQRVLWKFEDDQLPGKPANVLIKKWFPQPDILAQTNVKLFITHGGLLSTIESLYFGKPVL
GLPVFYDQHMNVARARRVGFGLGLDLYNLNEQDLEEAIHKLLSEPSFAKASAQISERYRD
QPQPSLERAIWWTEYVIRHQGAPHLRATSRDLNFIQLYSLDTLFVLVGLPLLLVALLLKV
SCRLLQGRKPKGCPYADKLKKQ
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgatggagcgccttttctcccccatagaacaaagctttttttcttatcagctaaaagct
tacgattatacatatatagtaggaaccttcagggaggtccactcaatcagtctttaccta
cggtccgccatgagaatacttttcgtgtttatcggttcgattttgttggctttgggcggc
ctaccgctgccggcggagggggccaaaatcttggccactctggcctggccgggacgctct
cagtacatctttgtggagaactatctgaagggattggcggcccgaggtcatgaggtcacg
gtgatcaacacattcaagaacaaggccacaccgaatatgcgtttcatagaggccctcaaa
gtccaagagtttcaccaacaaatgctagccgaattggaggcatccacgctgtggcaggaa
ctcaatgccatatcgggacttgaggaaaaggtcgcggcctttaccctggacgatgagggt
gtccagaagctgatgaaatctggcgagactttcgatgtggtgctggccgaaatgattgaa
gtaccagcgctgtacggaatggcacagcatttcaatgccaccttggtgggcttttccagc
tacggcagcgactaccggatcgacagtcaattggggaatacctcgccattgtcctataat
ccatcgattatgtcgccacgcaccgatcgcatgtccttctgcgagcgactcacgaaccac
tacgaatatctagtggaaatgctgcaccgccaattggtgcacctcccggccatggagcga
atgtacaacaagtattatccgaatgccaggcaaacgatggatgaggtcttggactcgttt
gccttggtgctgctgggacagcatttttcactgtcatatccacgcccttttctgccgaat
atgattgaggtgggaggattgcatattgcccacaagccccagcccctgccagaggacatc
aaggcgtttatcgagggagccgagcatggggtcatctacttctcgatgggctcgaatgtg
aaaagcaaggatctgccccaggagacacgcgatacgctgctcaagactttcgggaaactc
aagcagcgagtgctgtggaaattcgaagacgatcagttgccgggaaaacccgccaatgta
ctgatcaaaaagtggttcccccagccggatattctggcccaaacgaatgtcaagctgttc
atcacccacggcggattgctgagcaccatcgagagcctgtattttggcaagcccgtgctc
ggcctgcccgtcttctacgatcagcacatgaatgtggcacgcgctcgacgcgtgggcttt
ggcctgggcctggatttgtacaacctaaacgagcaggacctcgaggaggccatccacaaa
ctgctctccgaacccagctttgccaaggcctctgcccagatctcagagcggtatcgtgat
cagccccagccatcgctggagcgggccatttggtggaccgaatacgtcatcaggcaccag
ggtgcaccgcatctgcgtgccacatcgcgggatctcaacttcattcaactctacagcttg
gatacgctcttcgtactcgtgggtctgccgctgctgctggtggcactgctgcttaaagta
tcttgcagattgttgcagggccgtaaaccgaaaggctgtccgtatgccgataagctgaag
aaacagtag

DBGET integrated database retrieval system