KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19796
Entry
Dpse_GA19796      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K06103  calcium/calmodulin-dependent serine protein kinase [EC:2.7.11.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpo01001]
    Dpse_GA19796
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpo04131]
    Dpse_GA19796
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:dpo03037]
    Dpse_GA19796
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dpse_GA19796
Protein kinases [BR:dpo01001]
 Serine/threonine kinases: CAMK group
  CASK family
   Dpse_GA19796
Membrane trafficking [BR:dpo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Dpse_GA19796
Cilium and associated proteins [BR:dpo03037]
 Primary cilia and associated proteins
  USH complex and associated proteins
   Dpse_GA19796
SSDB
Motif
Pfam: Pkinase Guanylate_kin PK_Tyr_Ser-Thr L27 PDZ SH3_1 SH3_2 PDZ_6 SH3_9 PDZ_2 PDZ_4
Other DBs
NCBI-GeneID: 4800966
NCBI-ProteinID: XP_001358148
FlyBase: FBgn0079792
Position
2:complement(6472305..6507830)
AA seq 928 aa
MTEDEILFDDVYELCEVIGKGPFSIVRRCIHRESSQQFAVKIVDVAKFTASPGLSTADLK
REATICHMLKHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACH
YMRQILEALRYCHENDILHRDVRPACALLATVDNSAPVKLGGFGSAIQLPGTRETIETHG
RVGCPHYMAPEVVTRRLYGKGCDVWGAGVMLHVLLSGRLPFLGSGVRLQQSIARGRLSFE
APEWKSISANAKDLVMKMLAANPHHRLSITEVLDHPWIRDRDKLQRTHLAETVEELKRYN
ARRKLKGAVQAIAGGTTMDPVYVTDADMPIAGAPDEWADEEAGIEAVQRILDCLDDIYSL
QDAHVDADVMRDMLRDSRLHQLLQLFDRITSTVVTSNGRAPAAEAVTRSRDVLETLSSTA
GSSVANKYAKDELMLLLAAPHMQALLHSHDVVARDVYGEEALRVTPPPMVPYLNGDEMDN
VEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGRCIVARIMHGGMIHRQATLHVGDEI
REINGQPVQHQSVGQLQRMLREARGSVTFKIVPSYRSAPPPCEIFVRAQFDYNPLDDELI
PCAQAGISFQVGDILQIISKDDHHWWQARLDTVGGSAGLIPSPELQEWRIACQTVDKTKQ
EQVNCSIFGRKKKQCRDKYLAKHNAIFDNLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHG
VGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEESGRSYYFVSHDEMMADIAANEYLEYG
THEDAMYGTKLDTIRRIHTDGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADYD
GSLERLAKESEMLRQMYGHFFDMTIVNNDISDTISALETAIDRVHTTPQWVPVSWLYXQD
SELECPDCLEGCDCEWDAYTQASNVALY
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgaccgaagacgaaattctctttgacgatgtctacgagctgtgcgaggtcattggcaaa
ggacccttctccattgtgcgacgatgtatacatagggagtccagccagcagtttgctgtt
aaaatcgttgatgtggccaagttcacagcgagtccaggactgagcacagcggatctgaag
cgcgaggccacaatatgtcatatgctgaagcatccacacattgtcgagctgctggagacc
tacagctccgagggcatgctctacatggtgttcgagttcatggaaggctccgacctgtgc
ttcgaggttgtgcgtcgcgccgttgccggttttgtctacagcgaggcggtggcttgccat
tacatgcggcagatactggaggcgctacgatattgccatgagaacgatatactgcacagg
gacgtgcgtcccgcctgtgccctgctcgccaccgtggacaactcggcgccagtgaagctt
ggtggcttcggttcggccatccagctgccgggcacgagggaaaccatagaaacacacgga
cgcgtgggctgtccgcactatatggcgccggaggttgtcaccaggcggctgtacggcaag
ggctgcgatgtctggggcgctggtgtaatgctgcatgtcctactatccggcagattgccc
tttttgggctccggcgtgcgactacagcagtcgatagcgcgtggcaggctctcgtttgag
gcgcctgaatggaaatcaatttcggctaatgccaaggatctagtcatgaaaatgctggcg
gccaatccacatcacagactttccatcaccgaggtgctcgaccatccgtggatacgagac
cgggacaagctacagcgaacacatctcgcagaaacggtggaggaattgaagcgctacaat
gctcggcgcaagctcaagggtgccgttcaggccatcgccggcggcaccaccatggatccc
gtttatgtcaccgatgcggacatgcccattgctggggcacccgacgaatgggccgacgag
gaggcgggcatcgaggcggtccagcgtattctggactgcctggacgatatctattcgctg
caggacgcgcatgtggacgcggatgtgatgcgggatatgctgcgggacagtcggctgcat
cagttgctgcagctctttgatcgcatcacctcgacggttgtcaccagcaacggccgggcg
ccggccgcagaggcggtcacccgcagtcgggatgtcctggagacgctctcgtcgacggcc
ggcagttcggtggccaataagtatgccaaggatgaactaatgctgctgctggccgcccca
cacatgcaggccctgctccatagccacgatgtggtggcccgcgatgtgtacggcgaggag
gcgctgcgcgttaccccgccaccgatggtgccctacctcaatggcgacgagatggacaat
gtggagggcggcgagctgcagcatgtgacccgagtgcggctggtgcagttccaaaagaac
acggacgagccgatgggcataacgctgaagatgaccgaggatgggcgctgcattgtggca
aggattatgcacgggggtatgatacatcgacaggcaacgctgcatgtgggcgacgagata
cgggagatcaatggccagccggtgcagcatcagtcggtgggccaattgcaacgaatgctg
cgcgaggcacgcggttctgttaccttcaagatagttccttcgtaccgtagcgctccgcca
ccctgcgagattttcgtgcgcgcacaatttgattataatccgctggatgatgagcttata
ccctgcgcccaggcgggcatatcattccaagtgggcgacatacttcagatcattagcaag
gacgatcatcactggtggcaggcgagactggacacggttggtggctcggcgggcttgata
ccatcgccggagctgcaggagtggcgcattgcctgccagacggtcgacaagaccaagcag
gagcaggtaaactgttcgatattcgggcgcaagaagaagcagtgccgcgacaagtacttg
gccaagcataatgccatattcgataatctagatgtggtcacatacgaggaggttgtcaag
gtgccagtcggtgatccgaactttcagcgcaaaacgttggtgctattgggagcccatggc
gtgggcaggcggcatattaagaacaccttgatatccaagtatcccgataagtacgcctat
cccataccacatacaacgagacctgccaagcccgaggaggagagtggacgcagctattac
tttgtctcgcacgacgaaatgatggcggatatcgccgccaatgagtacttggaatatggc
acgcacgaggatgcgatgtatggcaccaagctggacactatccgacgcatacacacagac
ggcaagatggccatattggatgtggagccgcaggcactgaagatactacgcacagccgaa
ttcacgccctatgtggtcttcatagcggccccctcgctgcagaatatcgccgattacgat
ggcagcctggagcgtctggcaaaggaatcggaaatgctgcgtcaaatgtatggccatttc
tttgatatgacgattgtgaacaacgacattagcgatacgatttccgcgctggaaacggcc
atcgaccgggtgcacaccactccccaatgggtgccagtctcgtggctctactgacaagac
agtgaactggaatgccccgattgcctcgagggttgcgattgcgagtgggatgcatataca
caggcctccaatgtggcgctctactga

DBGET integrated database retrieval system