KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20020
Entry
Dpse_GA20020      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K03900  von Willebrand factor
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dpse_GA20020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dpo03110]
    Dpse_GA20020
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpo04147]
    Dpse_GA20020
Chaperones and folding catalysts [BR:dpo03110]
 Intramolecular chaperones
  Others
   Dpse_GA20020
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA20020
SSDB
Motif
Pfam: VWD C8 F5_F8_type_C TIL Pacifastin_I EGF_2
Other DBs
NCBI-GeneID: 4812368
NCBI-ProteinID: XP_001352900
FlyBase: FBgn0080016
UniProt: A0A6I8UBJ0 Q29DL3
Position
XR
AA seq 3840 aa
MAKKVIFLSVWLLLISHVWGEEGDLVMNDEDDEDINPLVQAVPDAVDNEVGRDERHISFS
LRNAPAVSARYSYAGSGGGGAEYGGGIKTSASAGGYGGALVNKLFGVFGKGNQGNFYGNG
GQSLAAYGKCSALELPMNVHSECHNGRCKVSCPAGYSFGQDIQVLEMFCSNDGWIIGNSI
FSVVPPCQAQCQPPCQNNGICLSAGVCQCPENYYGPACQQKKSVCASFPKAPKNSKVACM
NNICHAECMRGFQFPDGSAITNIECRNGQWKHAKTGLSKPPDCGPTCDPACTNGGQCISF
NVCQCSKMFRGGHCQYNIASCNVTNTNFNGNYKCAYDLEEARCTFNCPQVPGLKVQGRLD
IEYKCNYQQGQYLPSPLPKCIFPPGYTIRSSTSTQKVTQQAGRVYHGGFSGEMAYEIRTE
REKLLALLAKYRDLERRSEWWSSEETVVTPGRYSLYQSSELDVVIDKTPRPALCTTWGGI
NMKTFDGLVFKAPLSCSHTLITDKVSGTFDIILKACPYGSGYGCAHSLKVLWQSVLYTFE
NLNGTIQLSTPIKKLPMSVQVMGMKVMPVAQHVQIDLESVGLKLDWDHHQYVSVQAGPQM
WGKVGGLCGSLDGDSNTDFVSRTGKKVETVKAFADAWRVQDRSEMCLVENSAELDFGMES
CEQSRLQKAVSVCERLLANEKLGDCIKPFNYEALIRTCMADYCNCANREHPESCNCDAIA
MLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDVALSPTRDTCNEG
CFCPEGTVQYKDACITRELCPCTLRGKEFKPESTVKKNCNTCTCKNGQWRCTDDKCGARC
GAIGDPHYQTFDGKRYDFMGKCSYHLLKTPNMSVEAENVACSGAVSEALSFAAPDDPSCT
KSVTIRFVLRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFAD
GIRVWWDGVSRVYIDAPPSWRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTK
DTCQFKAETHQGPHPCTLNPERKAQAEKHCDWILQDIFQDCHFMVEPEQFYEDCLYDTCA
CKDELSKCFCPILSAYGTECMRQGVKTGWRMTVKECAVKCPMGQIFDECGDGCALTCDDL
PSKGSCNRECVEGCRCPHGEYINDQGECVPKQKCHCSFDGMTFRPGYKEVRPGEKFLDLC
TCQDGVWDCQDAEPGDKDKYPPSSELRSKCTKQPFAEFTKCAPKEPKTCKNMDKYVADST
ECLPGCVCMEGYVYDTSRLACVLPTNCSCHHAGKSYDDGEKIKEDCNLCVCQAGSWKCSE
NGCESTCSVWGDSHFSTFDGHDFDFQGACDYVLAKGVFENGDGFSITIQNVLCGTMGVTC
SKSLEISLSGHAQESLILSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVE
VIPLKLQVKWDEGTRVYVKLGNEWRHKVSGLCGNYNGNGLDDMQTPSLGLETSPMLFGHS
WKLQPHCSAPVAPIDACKSHPERETWAQLKCGALKSELFEQCHSEVPLERYWKRCIFDTC
ACDQGGDCECLCTAIAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKSCTPACAVETC
DNFLDQGIAERMCNRENCLEGCHIKPCDDGFIYLNDTYRECVPKAECKPVCMVRNGMTYY
EGDITYTDSCATCRCSKRKEICSGVKCNQPTLTTPAHSAPLVEGTTEAVPLATQNQTKCV
KGWTRWCDKDKDTSDKSVRLNDEEKVPRYDRMENVYGTCLKEYMTKVECRVKDTYEAPEQ
MDENVVCNLEEGLRCTGKCHDYELRAFCQCDQEPLPPIPKPTERPQIGLTCDAGVVEYKD
FPGDCHKFLHCQPKGVEGGWIYVEQTCGEYMMFNPTMFICDHIATVQELKPSCGKKPQPE
PESEPIKQCPEGKAWTDCANQCEHTCHYYGSILRKRGLCQPGEHCKPGCVDKLRPDCRML
GKYWRDEDTCVHADECPCMDKAEHYVQPHKPVFGEFEVCQCIDNAFTCVPNKPDPIPERP
LEEVPELQLLEPIFPVTLTPPLHCASDRLIPKIENGPHSVPDSIFNASSQLAPEHGPTKA
RLTKYNPRGSWSPSINDQMQYLELNFGRPEPFYGVVMAGSTDFDSYVTLFKILHSHDGVA
YHYLVDETEKPQMFNGPLDSRAPVQTLFKVPIEASSLRIYPLKWHGSIAMRVELLICGDK
EEPRTTISIPPTSTEHPAHLQEMECIDQMGVDDGKMYADQVQSSSVWQLPKPAKKPALLD
LLKLSTPLSWRPLSNTPNEFVEFDFLEPRNISGFVTKGGPDGWVTGYKVLFSKKKPTWNT
VLSPSGQPRIFEANVDGETERKHHFKKPILTQFLKVVPAKWERNINMRIEPLGCFKPYPE
IKRQVPVDNSPPTKCNICDGIASPQSSSSDCPCQSQLALFWDGNSCVQHNLCPCVENYVS
YPIGSKFENSACEECVCVLGGHKNCKPKKCPPCQDAKLRPVITSDCFCKCEPCPKQQRLC
PSSGDCIPEVLWCNGVQDCADDEDSSCRDSFTVEPDIKREKNETEIITCPAPVCPPQMKI
KIIEKKTRKMSKMFSFSKQVSIVDDGVTITKTKFVSSKEQVLSMPTQELDFQVEEQCDEF
TCVPIPSKLVDKNETISCTEPKCPEKYDVELDMSTAKAGDCLKYTCVLRPNKDDVCEISG
KSFTTFDGTLFKYGPCSHILARDIHNGSWSISVHQQCTDESRKICHKVITIQDIQAGNEL
ILLPHLKLKFNGFEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKV
GISSKFIRTVDGLCGFYNGNPRDDKRSPEGQIIANTENFGDSWYDKRVPKDQCGDLKCSR
EMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACDCMMANNGDPAACKCNILES
FVKKCLSVNPLVQLRTWRAVAQCEITCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDTC
FPGCYCPEGTVRKGPNCVPISDCKDCVCNAMGASNYMTYDRKGFSFNGNCTYLLSRDVVL
PGVHTFQVYVSMDDCKKLGQSSPVDGGSCAKSLHILNGDHVIHVQRVPLKPKSLQVLVDG
FEVKQMPYKDSWISLRQVVGKDLVLSLPESHVELTASFADLIFSLGVPSIKYGSKMEGLC
GDCNGNAANDLQPNPAKKKPGVDVIQSWQADEPRLGLTDAQKCLSEDVPKEQCIPLPPEK
DPCLQFYNAELFGKCPLVVDPISYVSACQQDICKPGNTQQGVCVALAAYAKECNQYGICT
TWRRPQLCPYECPSDMVYESCGCAKTCDTVKAMSEYDAVSLKSQTVIQTVKSDEMCINSE
RFEGCFCPPGQVLDAGKCVPEMACSKCDDGVHLPGEKWPKDKCTDCQCDENGKTSCVQKK
CQVEENICAEDYKPQIIVTKEECCPRYRCVPEPKDPTKLCLAPMMPVCGPGQFKKQKNDV
NGCPQYICECKPKEECEVLKPPRELLPGEELVKIEEGCCPTQKIVCKPELCPKPPISCPE
RFYEVKTTKEVDACCSTHSCMPPKNLCIVQYELDDSSKFTKQVGEKWTHAKDVCKRETCS
YGPDGNAQVLSTLEKCSTDCAPGFSYQRLDKSKCCGKCIQSSCVFEQKLYGANDLWKSAD
NCTLYSCLKKDNQLMVTSSKEICPDVAGCLSHLLYQDGCCKRCKLEPLVEDKSTCLPVSL
AESQTKEILKFSKSGHGVCVNAEPIKGFTDCQGACSSGSKYNTLTDMHEKFCTCCSIKSY
HPISVKMVCQDGHTYSQRHEVPANCGCSPCSELSDPPIDVRMLPDVQYPLLKLLGNHQDN
NT seq 11523 nt   +upstreamnt  +downstreamnt
atggcaaagaaagtgatatttttgtccgtgtggctgctccttattagccatgtgtggggc
gaggaaggagatctagtgatgaacgatgaggatgacgaggatataaaccccctcgtccag
gccgtaccggatgccgtcgataacgaagtcgggcgcgacgagcgccacataagcttctct
cttcggaatgcacccgcagtgagcgctcggtacagttatgccggatctggtggaggaggt
gcagaatacggtggtggcatcaagacctcggccagtgctggaggttatggaggggccttg
gtaaacaaattatttggagtctttggaaagggaaaccaaggaaatttttacggcaacggc
ggacagtctctggctgcctacggaaagtgttccgccctggagctgccaatgaacgtgcac
tccgagtgccacaatggtcgctgtaaggtctcttgtccagctggatatagcttcggccag
gacatacaagtcctggagatgttctgcagcaacgatggctggatcataggcaactccatt
ttctcggtagtgcctccctgccaggctcagtgccagccaccctgtcaaaacaatggcatc
tgtctctcagcgggcgtctgtcagtgtccggaaaactattacggacctgcgtgccagcag
aagaagtccgtgtgtgcttcgtttcccaaggctccaaagaactcaaaggtcgcctgcatg
aacaatatttgtcatgcggagtgtatgcggggattccagttccccgatggcagtgcaata
accaacatagaatgccgcaatggccagtggaagcacgcaaagaccggactgtcaaagccc
cccgactgtggccccacttgtgaccctgcctgcacgaatggcggtcagtgcatcagcttc
aatgtttgccagtgctccaagatgttccgcggtggccattgccaatataacatcgccagc
tgcaatgtgaccaacaccaacttcaatggcaactacaaatgcgcctatgacttggaggag
gctcggtgcaccttcaactgcccccaggtgcccggactaaaagtccaaggacgcttggac
attgagtacaagtgcaactatcagcagggacagtatcttccctcaccacttccaaagtgc
atatttcctcctgggtacaccatccgctccagcacatccacgcagaaggtgacgcagcag
gcaggacgcgtctatcacggcggctttagcggtgagatggcgtacgagatccggaccgag
cgtgagaagctgctagccctgctggccaagtacagggacctggagcgaagaagcgaatgg
tggtcatcggaggagactgtggtgaccccaggcaggtattccttgtaccagagcagcgag
ttggatgtggttattgacaagacaccgagacctgctctctgcaccacttggggaggcatt
aatatgaaaacctttgatggtttggtgttcaaggcaccattgtcttgctcgcacacgctg
ataacggacaaagtgtcgggaacctttgacatcatactgaaggcatgtccctacggttcc
ggctatggctgtgcccactccttgaaggttctctggcagtccgtgctctacaccttcgag
aatttgaatggaaccattcagctgtccacgcccatcaagaagctgcccatgtccgtccaa
gtgatgggcatgaaggtgatgcccgttgcacagcatgtgcagatcgatctcgagtctgtt
ggccttaaactcgactgggaccaccatcagtatgtctccgtgcaggccggacctcagatg
tggggcaaagtgggtggtttgtgcgggtccctcgatggcgattccaacaccgactttgtg
tcccggacgggcaagaaagtggagactgtcaaggcattcgccgatgcctggcgcgtccag
gatcgcagtgagatgtgcctcgtggagaacagcgccgagctggactttggaatggaatcc
tgcgaacagagcaggctgcagaaggcggtgtctgtttgtgagcgtctcctggctaacgaa
aagctgggcgactgcatcaaaccgttcaactacgaggccctgatacgcacctgcatggcc
gactactgcaactgcgccaatcgggagcatccggaaagctgcaactgcgatgcgattgcc
atgctggccaaagagtgtgccttcaagggcatcaagctggagcatggctggcgcaatctg
gagatttgtcccattagctgcggctttggacgcgtctatcaagcttgcggtcccaatgtg
gagcccacctgcgactcggatgtggccctatctcccaccagagacacctgcaacgagggc
tgcttctgtcccgagggcacggtgcaatacaaggacgcgtgcatcacccgggagctgtgt
ccctgcacgctgcgcggcaaggagttcaagccagagtcgacggtaaagaagaactgcaac
acctgcacctgtaagaacggccagtggcgatgcacggacgacaaatgcggtgcgcggtgt
ggggccatcggggatccacattaccagaccttcgatgggaagcgctacgacttcatggga
aagtgctcgtaccatttgctgaagaccccgaacatgtcagtggaggcggagaacgtagca
tgctcgggcgccgtctcggaggccttgagctttgccgcacccgatgatccgtcctgcacc
aaatcggtgactattcgcttcgtcctacgggatggcacaccctcggttattaaactagac
caggggctaaccaccattgtcaatgacaagcccattgccaagctgccgaagatgttgggc
ctgggagaggtattgatccgtcgggccagctccacttttctcactgtggagttcgccgac
ggcattcgtgtctggtgggacggcgtgtcgcgcgtatacatcgatgctccgcccagctgg
cgtggccagacacagggcctgtgcggcaccttcaactccaatacgcaggacgacttcctg
acgcccgagggcgatgtggagaccgccgtggaaccgtttgcagacaagtggcgcaccaag
gacacttgccagttcaaggcagagacccaccagggtccgcatccttgcacgcttaatccg
gagcggaaggctcaggcggagaagcactgcgactggatactccaggacatcttccaggac
tgccacttcatggtagaaccggaacagttctacgaggactgtctatacgacacctgcgcc
tgcaaggacgagctgtccaagtgtttctgccccatcctgtccgcctacggaacggagtgc
atgcggcagggcgtaaagacgggctggagaatgacggttaaggagtgtgctgttaagtgt
ccgatgggtcagatcttcgacgagtgcggcgatggatgtgccctaacctgcgacgatctg
cctagcaagggaagctgcaaccgggagtgcgtcgagggttgccgctgtccgcacggggag
tacatcaacgatcagggcgagtgtgtgcccaagcaaaagtgccattgcagcttcgatggc
atgaccttccggccgggctacaaagaggtgcgccccggggagaagttcctcgatctgtgc
acctgccaagacggtgtctgggattgtcaggatgccgagccgggcgacaaggacaagtat
ccaccctcgtccgagctgcgatccaagtgtaccaagcaaccattcgccgagttcacaaag
tgcgcccccaaggagccgaagacctgcaagaacatggacaagtatgtggcggattccaca
gagtgtctgcccggctgtgtctgcatggaggggtatgtgtatgacacctcccgcctagcc
tgtgtgctgcccaccaactgctcgtgccaccacgccggcaagagctacgacgacggcgag
aagatcaaggaggattgcaacctgtgcgtgtgccaggctggtagctggaagtgctcagag
aacggctgcgagtccacctgcagcgtctggggtgattcgcacttctccaccttcgatggc
cacgactttgacttccagggagcctgcgactatgttctcgccaagggcgtcttcgaaaat
ggcgatggcttcagcataaccatacagaatgtcctttgtggcactatgggtgtgacgtgc
tctaagtccttggaaatttccctgtctggccatgctcaggagtcgttgattctcagcgca
gattccgcttacagcactgatccgaacaagacacccattaagaagcttcgagacagcgtc
aactccaagggacacaatgcgttccatatctacaaggcgggcgtattcgtggtcgtagag
gtgattcccctcaagctgcaggtcaagtgggacgagggaactcgggtttatgtgaagttg
ggcaatgagtggcgccacaaggtcagcggattgtgtggcaactacaatggcaacggactg
gatgacatgcagaccccttccttgggtcttgaaaccagccccatgctcttcggacattcc
tggaagctacagccgcactgctcggctccggtggcgcccatcgatgcctgcaagtcacat
ccggagcgcgaaacctgggcccagctcaagtgtggtgctctaaagtcggagctgttcgag
cagtgccactcggaggtgcctctggagcggtattggaaacgctgcatcttcgacacgtgc
gcctgcgatcagggcggcgactgcgagtgtttatgcacggcaatagctgcctacgcggat
gcctgtgcccaaaagggcatcaatatacgctggagatcccagcatttctgtcccatgcaa
tgcgatccccactgctcggactacaagtcctgcactccggcctgcgctgtagagacctgt
gacaacttcctggatcagggcatcgcggagcgcatgtgcaacagggagaactgtctcgag
gggtgccacatcaaaccctgcgacgatggcttcatttacttgaacgacacctaccgcgag
tgtgtgcccaaggccgagtgcaagcccgtgtgcatggtacggaacggaatgacctactac
gagggcgacattacatacacggattcctgtgctacctgtcgctgctctaagcgcaaggag
atctgcagtggcgtcaagtgcaaccagcccacgcttaccacgcccgcccattctgctcca
ctcgtggaggggaccaccgaggcagtacctctggccacgcagaatcagaccaagtgcgtc
aagggctggacgagatggtgcgacaaggataaggacacctcggacaaaagtgtgcggctg
aacgacgaggagaaggtgccgcgctacgatcgcatggagaacgtatacggcacctgcttg
aaggagtacatgacaaaggtcgagtgtcgggtcaaggatacatacgaggcgcccgaacag
atggatgagaatgtggtctgtaacctggaggagggtctgcggtgcactggaaagtgccac
gactacgagctgcgtgccttctgccagtgcgaccaggagccacttccgcccattcccaag
cccacagaacggcctcaaatagggctgacctgcgacgctggcgtagtggagtacaaggac
ttccccggcgactgccacaagttcctgcactgtcagcccaagggagtagagggcggctgg
atctatgtggaacagacctgtggcgagtacatgatgttcaatcccaccatgtttatctgc
gaccacatcgccactgtccaagaactgaagcccagctgtggcaagaagccccagccggag
ccggagtcggagcccatcaaacagtgtcccgagggcaaggcctggacggattgtgccaat
cagtgcgagcacacctgccactattacggcagcatcctgcggaagcgcggtctctgccag
ccgggtgaacactgcaagcctggatgcgtggacaaactacggccggattgtcgcatgctc
ggaaagtactggcgggatgaggatacctgtgttcatgccgacgagtgcccctgcatggac
aaggccgagcactatgtccagccccacaagcccgtcttcggcgagttcgaagtctgccaa
tgcatcgacaatgcctttacctgtgtgccgaataagccggatcctataccggagcgacct
ttagaagaagtaccagagcttcaactccttgagcccattttccccgtaacgcttacccca
cccctgcactgcgcttcagatcggctcatcccgaaaatcgagaatggccctcattctgtg
cccgatagcatcttcaatgccagctcccaactggcccccgaacacggcccaaccaaggct
cgtctcaccaaatataatccacggggcagctggtcccccagcatcaacgatcagatgcag
tatctcgagctgaattttggtcggccagagcccttttatggagtggtcatggcgggcagt
actgactttgacagctatgtgacgctctttaagatcctgcacagccatgacggcgtagcc
tatcactatctggtggatgagacagaaaagccgcagatgttcaatggcccccttgattct
cgagcgcctgttcagaccctctttaaggtccccattgaagcaagctcgttgcgtatctat
cccctgaaatggcatggttccattgctatgcgtgtggagctgctgatttgcggcgataag
gaggagcctaggaccaccatttccattccaccaacaagcacggagcatccagcgcatttg
caggaaatggaatgcatcgatcagatgggtgtggatgatggcaaaatgtatgcagatcag
gtgcaatcgagcagtgtctggcagctgcccaagcctgccaagaagccggcactgttggac
ctactgaagctatcgacgcctctgtcctggcgccccttgtccaatacccccaacgaattc
gtggagtttgatttcctggagcctcgaaacatttccggttttgtgaccaagggcggcccc
gatggctgggtaactggctacaaggtactgttctccaagaaaaagcctacttggaacacg
gtgctatcaccaagtggacagccgcgcatctttgaggccaacgtggacggggagaccgag
cgcaaacatcactttaagaagcccatactcacacagttccttaaggtggtgccggccaag
tgggagaggaacattaacatgcgcatcgagcccttgggatgctttaagccatatcctgag
atcaagcgtcaagtgcctgtcgacaatagtccacccactaagtgcaacatctgcgatggc
attgcaagtccgcagtccagctccagcgactgcccctgccagagccagctggcacttttc
tgggatggaaacagttgcgtgcagcacaatctgtgcccctgcgtggagaactacgtcagc
tacccgatcggcagcaagttcgagaattccgcctgcgaggagtgtgtctgtgtcctcggc
gggcacaagaactgcaagcccaagaagtgtccgccctgtcaggatgccaaactgcgaccg
gtgatcactagcgattgcttctgcaagtgcgagccctgtcccaagcagcaaagattgtgt
ccttccagtggagactgtataccagaggtgctctggtgcaatggtgttcaggattgtgcg
gatgatgaggactccagctgcagagattcgttcactgttgagcccgacatcaagcgggag
aagaatgagactgagatcatcacctgtccagcgcccgtttgtcctccgcaaatgaagatc
aaaatcatcgagaagaagacgcgcaagatgtcaaagatgtttagtttctccaagcaggtg
tcgattgtagacgacggcgtgaccatcaccaagacgaagttcgtttcctccaaggagcaa
gtcctgtcgatgcccacgcaagagctggacttccaggtggaggagcagtgcgacgagttc
acctgtgtgcccatacccagcaagctggtggacaagaacgagacaatttcctgcacggag
cccaagtgcccggaaaagtacgacgtggagctggacatgagcacagcgaaggctggtgac
tgcttgaagtatacctgcgtcctcaggcccaacaaggacgatgtgtgcgagatcagcggc
aagagcttcaccaccttcgatgggaccctcttcaagtatggaccatgcagccacattctg
gccagagacatacacaacggaagctggtcaatatcggttcatcagcagtgcactgacgag
tcgcgaaagatctgccacaaggtgatcaccatccaggacatccaagccggtaatgagctg
atcctcctgccccacttgaaactcaagttcaatggcttcgagttcacggtacagcagctc
atcaactcgcccatctgcaaagcatcctttgtggtgtcgcagccgggcaagaccctcctg
gctgtttcgaccaagtacggcttctgggttcaactcgacgacattggcatcgtcaaggtg
ggcatctcctctaagttcatacgcactgtcgacggtctgtgcggcttttacaatgggaat
ccccgggacgacaagcgttcgcctgagggacagatcatcgctaacacggagaatttcggc
gacagctggtacgacaagcgagtgcccaaggatcagtgcggggatctgaagtgctccagg
gagatgcaggccaaggcactgcagctgtgcaatatcattcaccatcccacctttgcccgc
tgtcacaaggccgtgaactacaagcagttcttgaacaactattgccttgaggctgcatgc
gactgcatgatggccaacaacggggatcctgccgcctgcaagtgcaacattctggagagc
tttgtcaagaagtgcctgagtgtgaatccgctggtccagctgcgtacttggagggcggtg
gctcagtgcgagattacatgcccatcacctcttgtgcacacggactgctacaagcgacgc
tgcgaaccgtcgtgcgataacgtccatggcgatgactgccccgtgctgcccgatacctgc
ttcccgggctgctactgtccggagggcaccgtcaggaagggacccaactgcgtgcccatc
tctgactgcaaggactgtgtgtgcaatgccatgggagcctccaactacatgacctacgat
cgaaagggctttagcttcaacggcaattgcacttatctgctgtctcgcgatgtggtcctg
cccggtgtccacacattccaggtgtacgtcagcatggacgattgcaagaaactgggacag
agcagtcccgtggatggaggcagctgtgctaagtcgctgcacattctcaatggggatcat
gtgatccatgtgcagcgggtgccgctgaaaccgaaatccctccaggtcttggtcgatggt
ttcgaggtgaagcagatgccttacaaggacagctggatatctctgcgccaggtggtgggc
aaggacctggtgctttctttacccgagtcccatgtggaacttacggcctcgttcgcggat
ttgatcttctctttgggcgtgcccagcatcaagtacggcagcaagatggagggcctctgt
ggggactgtaacggaaacgcggccaacgatttgcagcccaatccggccaagaaaaagccg
ggagtggatgtcatccagagctggcaggccgacgagcccaggctgggactcaccgacgcc
caaaaatgcctcagcgaggatgttcccaaggagcagtgcatcccgctgccgccggagaag
gacccctgcctgcagttctacaacgcagagctgttcggcaagtgcccgctggtcgtagat
cccatttcatacgtctccgcgtgccagcaggatatctgcaagccgggcaacacccaacaa
ggagtctgtgtggctctggctgcatatgccaaggagtgcaaccagtacgggatctgcacc
acgtggcgaaggccccagctatgtccgtatgagtgtcccagcgacatggtgtacgagtcc
tgcggctgtgccaagacctgcgacaccgtcaaggccatgtcagagtacgatgctgtgagt
ctgaagagtcagactgtcatccagacggtgaagagcgatgagatgtgcatcaattcggag
cgattcgagggttgcttctgtccccctggacaggtgttggacgccggcaagtgtgttcct
gagatggcctgctcaaaatgcgatgatggtgtgcacctgccgggagaaaagtggccaaag
gacaagtgcaccgactgtcagtgcgatgagaacggcaaaacctcgtgtgtgcagaagaag
tgccaggtggaggagaacatctgtgccgaggactacaagccacagataattgttaccaag
gaggaatgctgccctagatatagatgcgttccagagcccaaggatcctaccaaactttgt
ttggcccctatgatgcctgtctgcggtccgggacagtttaaaaagcagaagaacgacgtt
aatggctgtcctcaatacatttgcgaatgcaaaccaaaggaagagtgtgaagtgctgaag
ccgccgagggagctgctgcctggcgaagagctagtcaagattgaggaaggttgctgtccc
acacagaaaatcgtctgcaagccagagctgtgtcccaagcctcccattagttgtccagag
cgattctacgaagtgaagaccacaaaggaggtcgatgcctgctgttccacccactcctgt
atgcctccgaagaatctgtgcattgtccagtacgagctggacgattcctcgaagttcacc
aagcaggtgggcgagaagtggactcatgccaaggatgtgtgcaagcgcgagacctgttcc
tatggccccgatggcaatgcacaggtgctgagcactctggagaagtgctcgacggactgt
gcgcctggcttcagctatcagaggctggataaaagcaagtgttgtggcaaatgcatccaa
tcttcctgtgtgttcgagcagaagttgtacggagccaatgatctctggaagtccgcagac
aactgcacgctctacagctgcctgaagaaggataaccagctgatggtcacctcctcaaag
gagatatgtccggatgtggccgggtgtctgtcccatcttctgtaccaggatggctgctgt
aaacgctgcaagttggagccgttggtggaagataaatccacttgtttgcctgtgtccctc
gccgagtcgcagaccaaagaaatccttaagttctccaaatccggccatggcgtctgtgtc
aatgccgaaccaattaagggcttcaccgactgccagggcgcctgctcgtccggatccaag
tacaacacactcaccgacatgcacgagaagttctgcacctgctgcagcataaagtcctac
cacccgatctcagtgaaaatggtctgccaagacggtcacacgtacagccaaaggcacgag
gtgccggccaactgtggctgctcgccctgctccgagctatcggacccaccgatcgatgtg
cgaatgctgccggacgtgcagtatccactgctgaagctgctcggaaatcatcaggataac
taa

DBGET integrated database retrieval system