KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20065
Entry
Dpse_GA20065      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez NOA36
Other DBs
NCBI-GeneID: 4803294
NCBI-ProteinID: XP_001360058
FlyBase: FBgn0080061
UniProt: A0A6I8USQ8
Position
2
AA seq 330 aa
MDIATKSSKSSFSIDNILDHKTRASHSPTATDAANRSQSRRTSAHSPVAATTSVVTIPKA
TMATASPPTTTSGPSIYDISRETVAAQYALKNLESSQVLSPTTLRFNPIYPDPASLFYQQ
MLNLQKNPSLFMPHFQAAAVAAAAAAQPTGYCDQYSPFAMDCEGFPNPASAAAALYCNAY
PAASFYMSNFGVKRKGGQIRFTSQQTKNLEGRFASSKYLSPEERRHLALQLKLTDRQVKT
WFQNRRAKWRRANLTKRSGSAAGSAGASSTAPSSNSSTSSAYGTALTLSSRRSGSGQQSD
EEDRMYLSEDEEDDDDEEEPAEPLADPLVK
NT seq 993 nt   +upstreamnt  +downstreamnt
atggatattgccaccaagtcaagcaaatcttccttctccatagacaacatattggatcat
aagacgcgagcgagtcacagtcccaccgccacagatgccgcaaatcgatcgcaatcgcgt
cgcacctctgcccacagtcctgtggcggcgacaacatctgtggttaccatacccaaggca
accatggccactgcatcgccacccaccaccacatcgggaccgtccatctatgatatatcc
cgcgagacggtcgccgctcaatatgccctcaagaatctggagtccagtcaggtgttgtcg
cccacgacgctgcgcttcaatcccatctatccagatcccgcctcgttattctaccaacag
atgctgaatctacagaagaatccttcgctctttatgccccacttccaggcagcagccgtt
gctgcagcagccgccgcccaaccgacaggctattgtgatcaatacagtccgtttgccatg
gactgtgaaggctttcccaatccggcctccgctgcagccgctctctactgcaatgcctat
ccggcggccagcttttacatgtccaattttggggtgaagcgcaagggcggccagatccga
ttcacgtcccagcaaacgaaaaatctcgagggccgtttcgccagctccaagtatctgtcg
cccgaggagcgccgccatctggcgctgcagctgaagctgacggatcgtcaggtgaagacc
tggttccagaatcgccgagccaaatggcggcgggctaatctcacgaaacgcagtgggtcg
gcagccggatcagcaggagcctcctcaacggcgcccagctccaacagcagcactagctcc
gcctacggcacagccctgacgttgagcagccgtcggagtggcagcggccagcagagcgac
gaggaggaccgcatgtatctgtcggaggatgaggaggacgacgatgacgaggaggagccg
gcggaaccattagccgaccccttggtcaagtga

DBGET integrated database retrieval system