KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20135Help
Entry
Dpse_GA20135      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00250  Alanine, aspartate and glutamate metabolism
dpo00330  Arginine and proline metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dpse_GA20135
   00330 Arginine and proline metabolism
    Dpse_GA20135
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Dpse_GA20135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 4812876
NCBI-ProteinID: XP_001353581
FlyBase: FBgn0080131
UniProt: Q2M042
Position
XR
AA seq 574 aa AA seqDB search
MLRLLRNTPARCSGQQQSVIQSHVRGLGSAIPELKLKDFSVENEPILSYRKDSPERKALQ
EALKATASNCEEIPIVIGGKEFKTSDVRHQVMPHDHAHKLAQFYYADKKLLQQAIKTAVE
TQPKWDRVPLAERLNIWEKAADLMATKYRQELNSATMLGQSKTVIQAEIDAAAELIDFIR
LNAYFLKEVSKYRPISEDIKVTKNSMRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGNA
VLWKPSDTAMLSNWRIFNIMREAGVPDGVVNFVPADGPVFGDTITASPHLAGINFTGSVP
TFNRLWKQVGNNIDNYINFPRLIGECGGKNFHFVHKSADVQSVVTSTIRSAFEYCGQKCS
ACSRMYVPESLWPEIKAGLQCEAEKLKIGDVQDISSFTSAVIDDKAFKRITSYIEHAKKS
PNLEIIAGGTYSDSKGYFVNPTIVVSKDPKDRIMVEEIFGPVLTIYVYKEADLAETMKLV
HTSTKFALTGAIFGQDENWVQTALEEFKWAAGNFYINDKSTGSVVGQQPFGGGRMSGTND
KAGGPHYILRWTSPQSIKETFVPLRDVNYPYMSE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgattgctacgcaatacgcccgccaggtgctccggccagcagcagagcgtaatc
cagagccatgtgcgaggtctgggctctgcgattccggagctcaagctaaaggactttagt
gtcgagaacgagccgattctgagctaccgcaaggattcgccggagcgcaaggccctacag
gaggctcttaaggccacggcctctaactgcgaggagattcccattgtgataggcggcaag
gagttcaagacatccgatgtgcggcatcaggttatgccccacgatcatgcacacaagctg
gcccagttctactatgccgataagaagctcctgcagcaggccatcaaaaccgctgtggaa
acgcagcccaagtgggatcgggtgccgctggccgaacgcttgaatatctgggagaaggcc
gctgatctgatggccacaaagtaccgccaggaattgaattcggccaccatgttgggacag
tccaagacggtcattcaagccgaaatcgatgcggcagcagagctgattgacttcatacga
ttgaatgcctacttcctgaaggaggtctccaaatatcgtcccattagtgaggacatcaag
gtcaccaagaattccatgcgatatcgtggcatcgacggctttattgccgctgtcagcccc
tttaacttcacggccattggcggcaacttgtcctacacccccgctttgatgggcaatgct
gtgctgtggaagccctctgacacggccatgctttccaattggcgcattttcaatatcatg
cgcgaggcaggagtgcccgatggcgttgttaactttgtgccagccgatgggccggtgttc
ggagacacgattacggccagtccccacctggcaggcatcaatttcaccggctctgtgcca
acattcaaccgcttgtggaaacaggtgggcaacaatattgacaactacatcaactttccc
cgcttgattggcgagtgtggtggcaagaacttccacttcgtgcacaaatcggcggacgtc
cagtcggtagtcacatcgacaatacgctcggccttcgagtactgcggacagaagtgctcg
gcttgctcgcgcatgtatgtgcccgagtctctgtggccagagatcaaggctggcctgcag
tgcgaggcggagaaactaaaaataggcgatgtccaagacatcagcagcttcacatcggct
gtcattgatgacaaagcatttaaacgcattaccagctatatagagcatgccaagaagtct
ccgaacctggagataatcgccggcggtacctactcggacagcaagggctactttgtaaat
ccaaccattgtggttagcaaagatcccaaggatcggatcatggttgaggagatcttcggg
cccgtgctgaccatctatgtgtacaaggaagcggacttggcggagaccatgaagctggtt
cacacctccacaaagtttgccctaactggcgcaatattcggacaagacgagaattgggtc
caaaccgctttggaggagttcaaatgggctgccggaaacttctacatcaatgacaagtcg
accggatcggttgtgggccaacagccattcggtggcggtcggatgtccggtaccaacgac
aaggctggcggaccccactacattctacgctggacttcaccgcagtccatcaaggagacg
tttgtgcccctgcgtgacgtcaactatccctacatgagcgaataa

DBGET integrated database retrieval system