KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20156Help
Entry
Dpse_GA20156      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00020  Citrate cycle (TCA cycle)
dpo00480  Glutathione metabolism
dpo01100  Metabolic pathways
dpo01200  Carbon metabolism
dpo01210  2-Oxocarboxylic acid metabolism
dpo01230  Biosynthesis of amino acids
dpo04146  Peroxisome
Module
dpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dpse_GA20156
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dpse_GA20156
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dpse_GA20156
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Dpse_GA20156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 4813939
NCBI-ProteinID: XP_001354101
FlyBase: FBgn0080151
UniProt: Q2LYM2
Position
XR
AA seq 448 aa AA seqDB search
MFAIRRTATLMTARRPPLIRAVFQANFASSAVMAQKIRAGPVVDVLGDEMTRIIWQSIKD
KLILPFLDIELHTFDLGIEYRDQTEDKVTIDCAEAIKKYNVGIKCATITPDEKRVEEFNL
KKMWKSPNGTIRNILGGTVFREAIICKNVPRLVSGWQKPIVIGRHAHADQYKAVDYVVPG
PGKLTLTWKGNDGQVIDEVINDFKGPGVALGMFNTDDSIVDFAHASFKFALDRKLPLYMS
TKNTILKKYDGRFKDIFEDIYNKEYKKQYEAAGIWYEHRLIDDMVAYAMKSEGGFVWACK
NYDGDVQSDSVAQGYGSLGLMTSVLLCPDGKTVEAEAAHGTVTRHFRFYQQGKETSTNPI
ASIFAWTRGLLHRAKLDDNVPLQQFAETLEQVCIDTIEGGAMTKDLAICIKGSISAVERK
DYQETFEFMDTLAKNLEAALAKSAAAAK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctatccgccgcactgccacactgatgacggcccgccggccgccattgatacgc
gccgtcttccaagcaaacttcgccagcagcgccgtgatggcccaaaagattcgtgctgga
cccgtggtggatgtgctcggcgatgagatgacccgcatcatctggcagtcgatcaaggac
aagctgatcctgcccttcctggacatcgagctgcacacatttgatttgggcattgagtac
cgcgaccagaccgaggacaaggtcaccatcgactgtgccgaggccatcaagaagtacaat
gtgggcatcaagtgcgccaccatcacgcccgacgagaagcgcgtggaggagttcaatctg
aagaagatgtggaagtcccccaacggtaccatccgcaacattctcggaggaaccgtcttc
cgcgaggccatcatctgcaagaatgtgcctcgcctggtctctggctggcagaagcccatc
gtgatcggtcgccacgcccacgccgatcagtacaaggctgtcgattatgtggttcccgga
cccggcaagctcaccctcacctggaaaggcaacgacggccaggtcatcgatgaggttatc
aacgacttcaagggtcccggcgtcgccctcggcatgttcaacactgacgattccatcgtg
gactttgcccacgcctcgttcaagtttgcgctggaccgcaagctgccgctttacatgagc
accaagaacaccatcctaaagaagtacgacggtcgcttcaaggacatcttcgaggacatc
tacaacaaagagtacaagaagcagtacgaagccgccggcatctggtatgagcaccgtctc
atcgacgacatggtcgcctatgccatgaaatccgagggcggcttcgtgtgggcctgcaag
aactacgacggtgatgtgcagtccgattccgttgcccagggctacggttctctgggtctg
atgacctccgtgctgctctgccccgatggcaagaccgtcgaggccgaagccgctcacgga
acagtgacccgtcacttccgtttctaccagcagggcaaggagacctccaccaatcccatt
gcctcgatcttcgcctggacccgtggcctgctccaccgcgccaagctggacgacaacgtg
ccactgcagcagttcgccgagactctcgagcaggtgtgcatcgacaccatcgagggcggt
gccatgaccaaggatctggcaatctgcattaagggcagcattagcgccgtcgagcgcaag
gactaccaggagacctttgagttcatggacacactggccaagaatctggaggctgctctc
gccaagagcgccgccgctgccaagtga

DBGET integrated database retrieval system