KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20258Help
Entry
Dpse_GA20258      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00040  Pentose and glucuronate interconversions
dpo01100  Metabolic pathways
Module
dpo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA20258
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     Dpse_GA20258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 DUF1776 RmlD_sub_bind 2-Hacid_dh_C ADH_zinc_N Shikimate_DH NAD_binding_2 Polysacc_synt_2 ApbA ThiF 3Beta_HSD NmrA
Motif
Other DBs
NCBI-GeneID: 4814533
NCBI-ProteinID: XP_001355103
FlyBase: FBgn0080253
UniProt: Q29GF0
Position
XL
AA seq 242 aa AA seqDB search
MWADLKNKVILVTGAGAGIGQALVKELAGAGATVIAVARSEAQLKELAAFDPKHIQPLQL
DLAEWQPVREALAKVPLLDGLVNNAGVAIIKPFEELTEQDFDTHFNVNIKAVFNVTQALL
PKLRDGASIVNVSSIAASRSFAGHTAYSATKAALDSLTKSLALELGPRRIRVNSVNPTVV
LTKMGRDNWSDPGKSGPLLAHIPLNRFCEVQEVVDATGYLLSNKSSFVNGHHILLEGGYA
VS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccgatctcaaaaacaaggtgattttggtgacgggcgcgggtgcgggcatcggc
caagcactggtcaaagagctggcaggcgcaggagccacggtcatagcagtggcccgcagc
gaggcccagctcaaggagctagctgcctttgatcccaagcacattcagcccctgcagctg
gacctggccgagtggcagccggtgagagaggccctggcgaaggtgccgctcttggacgga
ctggtgaacaatgccggagtggccatcatcaagccattcgaggagctcaccgaacaggac
tttgatacccactttaatgtgaacatcaaggccgtcttcaatgtgacccaggccctgctg
cccaagctccgcgatggagcctccattgtgaatgtctcctcgatagcggcgtcgcgctcg
tttgccggtcataccgcgtacagtgccaccaaggcggccctcgactcgctgaccaagtca
ttggccctggagctggggccacgtcggatacgagtcaattcggtcaatcccacggtggtg
ctgaccaaaatggggcgtgacaactggtcggatcccggcaagagtggacccctgctggcc
cacattccgctcaataggttctgtgaggtgcaggaggttgtcgatgccactggctacctg
ctgagcaacaagtccagcttcgtgaatggccatcacattctgctggagggcggctatgcc
gtatcctag

DBGET integrated database retrieval system