KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20265
Entry
Dpse_GA20265      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB
Motif
Pfam: Abhydrolase_1 Abhydro_lipase Hydrolase_4 Chlorophyllase2
Other DBs
NCBI-GeneID: 4816695
NCBI-ProteinID: XP_001356050
FlyBase: FBgn0080260
UniProt: Q29KR5
Position
4
AA seq 470 aa
MLWSGTYAMQHASWILGPLWLALQCMRVAGGYLEDNFPASVIEDAHLSTMQLLEKYKYPA
EAHQVTTEDKYVLTIHRIPRPGAQPVLLVHGLEDTSSTWILMGPHSGLGYFLYSQGYDVW
MGNVRGNRYSRGHLQLNSNTDRAYWTFSWHEIGMYDLPAMIDGVLAKTGFQKLGYFGHSQ
GTTSFFVMASSRPEYNAKIHLMSALAPVAFIAHVKAPLLGLARVGINLLGESFELFPHSD
IYLKQCVQSAGMLKTCLRFYWQIIGKNREELNMTMFPVVLGHLPGGCNVKQAMHYMQLQR
SDRFCQYDYEAKENQKVYGRTTPPDYRLERVTAPVALYYGSNDYLSAVEDVQRLAKILPN
VVENHLYKKWNHMDMLWAISARRSIQPKLLEVMKYWESVGGRKNAESTTSFPVEEEVPQP
VTEPAPAGENDVGESYDDETEVEGINEKGQEDGKGQDQQQDEAVEPPSEE
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgctttggtcaggaacgtacgccatgcaacacgctagttggattctcggcccgctctgg
ctcgcgcttcagtgcatgcgggtggccggaggctatctggaggacaactttccggccagc
gtgatagaggacgcccatctgagcacgatgcaactcttggagaagtacaagtatccggca
gaggcccaccaggtgaccaccgaggacaagtacgttttgaccattcacagaattccacga
ccaggggcccagcccgtcctgctggtacacggcctggaggacacctcttccacctggata
ttgatgggtccgcacagtggtctgggatactttctgtacagccaaggctacgacgtgtgg
atgggcaatgtgcgaggcaaccgctactcgcgcggccacctgcagctgaactccaacacg
gaccgcgcctactggaccttctcctggcacgagattgggatgtacgacctgcccgccatg
atagacggtgtcctcgccaaaacgggctttcagaaactcggctacttcgggcactcccag
ggcaccacttcgttctttgtgatggcgtctagtcgccccgagtacaacgccaagatccac
ctgatgagtgctctggcgccagtggcctttatagcgcacgtaaaggctcctctcttgggc
ttagccagagttggcatcaaccttctgggggagtcctttgagctattccctcactcggac
atatacctcaagcagtgcgtgcagtcggccggcatgctcaagacctgccttcgtttctac
tggcagatcatcggaaagaaccgcgaagaactcaacatgaccatgttccctgtggtgctg
ggccatctcccaggtggctgcaatgtcaagcaagccatgcactacatgcagctgcagaga
tctgatcggttctgccagtacgactacgaagctaaggagaatcagaaggtgtatgggcgc
acgacgccccccgactaccgactggagagggttactgcaccggtcgcgctgtattatggc
agcaatgactatctttccgctgtcgaggacgttcagcgcctggccaagattctgcccaat
gtggtggagaaccatctgtacaagaagtggaaccacatggacatgttgtgggccattagt
gccaggcgctcgatacagcccaagctgctcgaagtaatgaagtactgggagtcagttggt
ggcaggaagaatgccgagtctaccactagttttccggtggaggaagaggttccacagccg
gtaacagaacctgcccccgcgggggagaacgatgtaggagagagctatgatgatgaaacg
gaagttgaaggaataaatgagaaagggcaggaagatggaaaaggacaggaccaacagcag
gacgaagctgttgagccaccttccgaggagtaa

DBGET integrated database retrieval system