KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20320Help
Entry
Dpse_GA20320      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04013  MAPK signaling pathway - fly
dpo04068  FoxO signaling pathway
dpo04624  Toll and Imd signaling pathway
dpo04933  AGE-RAGE signaling pathway in diabetic complications
Module
dpo_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA20320
   04068 FoxO signaling pathway
    Dpse_GA20320
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dpse_GA20320
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dpse_GA20320
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dpse_GA20320
Protein kinases [BR:dpo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dpse_GA20320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 4816406
NCBI-ProteinID: XP_001356250
FlyBase: FBgn0080315
UniProt: Q29K65
Position
4
AA seq 365 aa AA seqDB search
MSRKMPKFYKLDINRTEWEIPETYQSLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQ
SAVHAKRTYRELRLLKHMEHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNII
RTQKLSDDHVQFLIYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAES
EMTGYVATRWYRAPEIMLNWMHYNKTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIME
VLGTPAEEFMSRISSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADQRI
TAEQALAHPYMEKYHDPTDEQTAALYDQSFEENELPVEKWREMVFTEVQAFRPTQAFAEL
LPKDL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaaaaatgccgaagttctacaagctagacataaatcgcacggagtgggagata
ccagagacataccaaagccttcagcccgtcgggcagggggcctacggtcaggtgtgcaag
gctgttgtccgaggaaccagcacaaaggtagcgataaagaaactggcgcggccctttcag
tcggccgtgcatgccaagcgaacgtaccgtgagctgcgcctactgaagcacatggagcac
gagaatgtaattggtctcctggacgttttccatcccggacagcccgccgactcgctggac
cagtttcagcaggtctacatggtgacgcatctcatggacgcggacctcaacaacataata
cgcacgcagaagttgtctgacgaccacgttcagttcctgatataccaaatcctaagaggc
ttaaagtatattcacagtgccggggtgatacatcgcgatttgaaaccgtccaacatcgcg
gtgaacgaggattgcgagttgcgcatcttggatttcggtctggcacgacccgcagaaagc
gagatgactggctatgtggccacgagatggtatcgggcaccggaaatcatgctcaactgg
atgcactacaacaagacggtggacatttggtctgtgggatgcatcatggccgagctcttg
accggacgcaccctcttccccggcaccgatcacattcatcagctgaacctgatcatggaa
gtgctgggcacgccggcggaggagtttatgagccgcatctcctcggagagtgccagaaac
tacatacggtcgttgccagtgatgccgagacgaaactttcgagacatctttcgtggggcc
aatccgctggcgatcgacctgctggagaagatgctcgagctagatgccgaccagcgcatc
acagccgagcaggcgttggcccatccctatatggagaagtaccatgaccccaccgacgag
cagacagcggccttgtacgaccagagcttcgaggagaacgagttgcccgtggagaagtgg
agggaaatggtgttcaccgaggtgcaagccttcaggcccactcaggccttcgccgagctc
ctgccgaaggatttataa

DBGET integrated database retrieval system