KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20328Help
Entry
Dpse_GA20328      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06634  cyclin H
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo03022  Basal transcription factors
dpo03420  Nucleotide excision repair
Module
dpo_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dpse_GA20328
  Replication and repair
   03420 Nucleotide excision repair
    Dpse_GA20328
Transcription machinery [BR:dpo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dpse_GA20328
DNA repair and recombination proteins [BR:dpo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Dpse_GA20328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB Cyclin_C Bcr-Abl_Oligo
Motif
Other DBs
NCBI-GeneID: 4812829
NCBI-ProteinID: XP_001353506
FlyBase: FBgn0080323
UniProt: Q2M0B7
Position
XR
AA seq 324 aa AA seqDB search
MYPVSSQKKSWTFANESQLLAFRVEQNSKYIGEHDSECQDSDLEEFFLTPAEERLLLKQY
EVYLFDFCRRFDPPMPKCVVGTAFHYFKRFYLNNTPMDYHPKEILATCVFVACKVEEFNV
SISQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNP
DRLRPHIESFIDSTYYTDACLLHTPSQIGLAAVLHAASREQENLDSYVTDLLFVSARDKL
PSLIDAVRKIRIMVKQYQQPDRDKVKAIEKKLDKCRNQANNPDSELYKERLRRMYTDEDD
IPAEDASFHIADVSSDTSAMNTSQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctgtgagctcgcagaaaaaatcctggacatttgccaatgagtcgcagctgttg
gcctttcgtgtggagcagaattccaagtacattggagagcacgactccgagtgtcaggat
agcgacctagaggaattttttctcacgccggcggaggagcgcctgctgctgaagcaatat
gaagtctatttgtttgatttttgccgacgcttcgatccgcccatgcccaaatgtgtggtg
ggcaccgcatttcactatttcaagcgtttctatctgaacaatacgccgatggactatcat
cccaaggaaatactagccacctgtgtgttcgttgcctgcaaggtggaggagtttaacgtg
tccataagtcagtttgtcaacaatatcaagggcgaccggaacaaagccacagacattgtg
ctgtctaatgagctgctgttgattggccaactgaactactaccttaccatacacaatccg
ttcagacccattgaggggtttcttatagacataaagactcggagcaatatgcagaacccg
gatcgtttacgtccacatattgaaagcttcatcgattccacttattacacggatgcctgc
ctgttgcatacaccgtcacagatcggcctagccgctgtgctgcatgcggccagccgagag
caggagaatctggacagctatgtgactgatttgctgtttgtgtcagcgcgggataagctg
ccaagtcttattgatgccgtacgaaaaatccgtatcatggtcaaacagtaccagcaaccc
gatcgggataaggtcaaagccatcgaaaaaaaactagataagtgccgcaatcaggcaaat
aacccagacagtgaactgtataaggagcgcttacggcgaatgtacactgatgaggacgat
attcccgctgaggatgcctcttttcatattgctgatgtgagctcggacacctccgctatg
aataccagccaataa

DBGET integrated database retrieval system