KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20334Help
Entry
Dpse_GA20334      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpo01002]
    Dpse_GA20334
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     Dpse_GA20334
Peptidases [BR:dpo01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   Dpse_GA20334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 4801704
NCBI-ProteinID: XP_001358750
FlyBase: FBgn0080329
UniProt: Q298R2
Position
2
AA seq 786 aa AA seqDB search
MFLLQRIQRSRPQLNRLCHIRIRAGSSLSLTPYRGAGADPRNIVRLATQLIRYSSSANIP
QPAEMPSKTSHFVLPNTQPIADLECKNAFENLTDKEKLYAHYFSKASWDGGLIALIQSSP
EAPLIFSLLHRIFVAEKPEQLKAKALAAGVTEDEFTGFLVYACGVFANAGNYKGMGDSKI
LPNLSPEKFETVVRASGAYEANQRVAKIYEKVKGLIYALESRNEILGFAPNGITTYWSDN
CTKEDSDIVNSWLTSKRIEPYMCRTFKIVEEGKTIYDIKLGSVADSLKDGITLPLEEYKG
NNFRVTRGDYRKLLQRVNQNLLEAQKYAANENEAKMIEHYIKSFEEGSLDEHKDGSRWWI
KDKGPVIETYIGFIETYRDPAGGRAEFEGFVAMVNKESSAKFTELVDRAEQLLEYLPWTE
PYEKDSYLKPDFTSLDVLTFAGSGVPAGINIPNYDEIRQDEGFKNVSLGNVLANINRKDP
IPFLTEEDQTLMKEYKVKAFEVQVGLHELLGHGSGKLFRIDENGAYNFDKETTKNLITGE
PIAKWYLPGETYDTKFGAIGSSYEECRAEAVGLYLSLQRDILEIFGFKDAVEQDNIIYIN
WLSLIWNGMGVALEMYNPKSKQWLQAHSRARFVIMKVLLEAGEGLVTVEETEKGKDLLLT
VDRSKIETVGKKALGDFLTKLQVYKSTADIEAATKMYEHYSEVNDSGSHPWAQWRDICLA
HKKPRMILVQANTEVKDKKVELKTYEASHEGYIQSWVERYPTTDVDDLLDQIVEQDKQYF
PTAFSK
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgctgcaaagaattcagaggtctcgtccacaactgaacagactttgccacata
cgtatccgtgccggcagcagtctcagccttacgccttacagaggtgccggtgcagacccc
agaaacattgttagactcgcgacacagttgattcgctacagttcgagtgcaaatattcca
caacccgctgagatgccaagcaaaacatcgcactttgtgttgccaaatacgcagcctatt
gccgatttggagtgcaagaatgcctttgagaatctgacagacaaggagaagctctatgcc
cactacttcagtaaggcgtcgtgggatggcggactcattgctctcatccaatccagtccc
gaggcgccattgatcttctccctgctgcatcgcatctttgtggccgagaagccggaacaa
ctgaaagccaaggccttggcagctggcgtcactgaggatgagtttacgggcttcctagtc
tacgcttgcggcgtgttcgccaatgccggcaactacaagggcatgggtgatagcaagatc
ttgccaaatctttccccagaaaagttcgagacagtcgtacgcgcttcgggtgcctacgag
gccaatcagcgtgtggccaagatctacgagaaagtcaagggtctaatttatgcattggaa
tcacgtaatgaaatccttggattcgcaccgaatggcattaccacctactggtcagacaac
tgtaccaaggaggactcggatatagtcaactcctggctgacatcgaagcgcatcgagccg
tacatgtgccgcaccttcaaaatcgtggaggagggcaagaccatctacgatatcaagctc
ggatcggtagccgactcccttaaggatggcattacgctaccgcttgaggagtacaagggc
aacaatttccgtgtcacccgcggcgactaccggaagctgctgcagcgcgttaatcagaat
ctgctggaggcccagaagtatgcggctaatgagaatgaggccaagatgatcgagcactat
atcaaatcctttgaggagggctctctggacgagcataaggacggttccaggtggtggatc
aaggacaagggacccgtcattgagacctacattggtttcattgagacgtacagggatccg
gcaggtggtcgcgccgaattcgagggttttgtcgccatggtcaataaggagagttcggct
aagttcaccgagctggtcgatcgagccgagcagctgttggagtacctgccttggacagag
ccatacgagaaggactcgtatctgaagcccgactttacctcgctagatgttctcaccttt
gctggcagcggagtgccagctggcatcaacataccaaactatgacgagatccgccaggat
gagggatttaagaatgtatccttgggcaatgtgctagccaacatcaatcgcaaggatccc
attccattcctcaccgaggaggaccaaacgttgatgaaggagtacaaagtgaaggccttt
gaagtgcaagtgggtcttcacgagctgctgggccatggcagtggcaagctgttccgcatc
gatgagaacggggcctataacttcgacaaggagaccacaaagaaccttatcacgggcgaa
cccatcgccaagtggtatctgccgggtgaaacatacgacacgaagttcggtgccatcggt
tcctcatacgaggaatgccgtgcggaggctgtgggtttatatctgtccctgcagcgggac
atcttggagatattcggcttcaaggatgccgtcgagcaggacaacatcatctacatcaac
tggctaagtctcatctggaatggcatgggtgtggctctggaaatgtacaatcccaaatcg
aagcagtggctgcaggcccattctcgtgctcgttttgtcattatgaaagttctactcgag
gcgggcgagggtctggtaaccgtcgaagaaacggaaaagggcaaggatctgttgctcacg
gtggaccgaagcaagatcgaaaccgtcggcaagaaggccctgggtgatttcctcaccaaa
ctccaggtgtacaagtccacggccgacatcgaagcggccacgaaaatgtacgaacactac
tcagaggtgaacgacagtggttcgcatccttgggcccagtggcgcgatatatgtctggcc
cacaagaagccacgcatgatcctcgtccaagccaatactgaagtcaaggacaagaaggtg
gagctgaagacgtacgaggccagccacgagggctacattcagtcctgggtagagcgttac
cccaccacggacgttgacgatctgttggaccaaattgttgagcaggacaaacaatacttt
ccaactgcattttcaaaatag

DBGET integrated database retrieval system