KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20617
Entry
Dpse_GA20617      CDS       T01032                                 

Name
(RefSeq) uncharacterized protein, isoform A
  KO
K02607  origin recognition complex subunit 5
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpo01009]
    Dpse_GA20617
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dpo03032]
    Dpse_GA20617
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dpse_GA20617
DNA replication proteins [BR:dpo03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    Dpse_GA20617
SSDB
Motif
Pfam: ORC5_C AAA_16 AAA_22 TsaE AAA TniB ABC_tran AAA_19 AAA_7 CRPV_capsid DUF815 AAA_33 ATPase_2
Other DBs
NCBI-GeneID: 4816621
NCBI-ProteinID: XP_001356239
FlyBase: FBgn0080611
UniProt: Q29K76
Position
4
AA seq 499 aa
MIAAHYRLHAGAIGYSAGKYSHFCALYPRQLFVSKSQMENICAALEPLFPCREGAIKTLG
ELIGDSREDYPSALYLFGHSGTGKTALTRTFLRECSRQQGVRIAQLNAIECYTTKIMLEN
MLDTLAPRQCTEESVRADNMLEFVEQLRRWHDQGGRSQSFLIAVDNAERLRDMDANVLPV
LLRLQQLTSLNLCVILLSQIPFEKFYNKTGLTEVISIHLAQYNKAETQRILGSDFFQVRG
HLLEQFSKDVQRLAICEAALTEDFYSNYLNLFLSVFYKACRDVPELQLTARKCFSIYLEP
VLDGTVESTDVSRLWRHIAGPLRSALTQIYMRTEKPPEEQEGSAPIEDQSVRKLAQSLEL
PYYAKYLLIAAFLASHNSANQDKRLFVKHHGKQRKRMQTVNARAKTTEKMSTTLGPKSFT
IDRLLAIFYAILEEKVGLTCNLLSQISTLVHLKLLSFVSGEQNIMDGSARLQCTVGLEFV
LYIGKVVGFNVRQYLCDFM
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgattgcggcccactatcgcttgcatgccggcgcaatcggttacagtgctggaaaatac
tcgcacttttgcgcgctttatccccggcagctgtttgtaagcaaatcgcaaatggaaaat
atctgcgctgcgttggagccgctgtttccctgccgggagggagcaatcaaaacactgggc
gagctgattggcgactcccgggaagactatccttccgccctctatctgttcgggcacagt
gggacggggaaaacagccctgaccagaacattcctccgagagtgcagcaggcagcaagga
gttcgtattgcccaactaaatgccatcgagtgctataccacaaaaataatgctggagaat
atgctggacacactagctccgcgtcagtgcacagaggaatccgttcgcgccgacaacatg
ctggagtttgtggagcaactgcgtcgttggcatgaccagggagggagatcccagagcttc
ttgatagccgtggacaatgctgagcgcttgcgagacatggatgcaaacgttctacccgtt
ctgctgagactgcagcagctgaccagcctcaatctctgtgtgattctcctgtcccagatt
cccttcgaaaagttttataacaaaacgggtctgactgaagttatcagcatccatttggcc
cagtacaacaaggcagagacccagcgtattctcggctcggactttttccaggtgcgaggg
cacctccttgagcaattttcaaaggatgtccagcgcctcgcgatctgcgaagcggccctc
accgaggacttctacagcaactacctaaatctcttcctcagcgtcttctacaaggcttgc
cgagacgtgcccgagctgcagttgacggccaggaaatgtttctccatttacttagagcct
gtgttagatggcacggtggagtctacagatgtctcccggctgtggagacacattgccgga
cccttgagatccgcgctcacccagatatacatgcgaacagaaaagcctccggaagagcag
gaaggatcggcacccatcgaggatcagagcgttcgcaagctggcgcagtcgctcgagttg
ccctactacgccaaatatctgcttattgccgcattcctggccagccacaattccgccaac
caggacaagcgactgttcgtcaagcatcatggaaagcagcgcaagagaatgcagacggtg
aatgcccgagccaagactacggagaagatgtccacgaccctgggacccaaatcctttacc
atagatcgcttgttggccatcttctacgccattcttgaggaaaaagtgggcctcacctgc
aacctgctgtcccagatctccacattggtccacctcaagcttctcagctttgtctccggc
gaacagaacatcatggacggctcggcccggctccagtgcacggtgggcctcgagtttgtg
ctatacatcggcaaggtggtcggcttcaacgtgcgccaatatctttgcgatttcatgtag

DBGET integrated database retrieval system