KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20753Help
Entry
Dpse_GA20753      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00052  Galactose metabolism
dpo00561  Glycerolipid metabolism
dpo00600  Sphingolipid metabolism
dpo00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dpo01100  Metabolic pathways
dpo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dpse_GA20753
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dpse_GA20753
   00600 Sphingolipid metabolism
    Dpse_GA20753
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Dpse_GA20753
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dpse_GA20753
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dpse_GA20753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 4803800
NCBI-ProteinID: XP_001360458
FlyBase: FBgn0080744
UniProt: Q291S9
Position
3
AA seq 417 aa AA seqDB search
MYIASSVFFGTFLLLLLLHGGMGLDNGLALTPPMGWMSWERFRCLTDCKLYPNECISEEL
FRRHADLLVSEGYADAGYEYIIIDDCWLEKNRDNKTKKLVADKKRFPNGLNPLADHIHNI
GLKFGLYQDYGTNTCAGFPGVIKHMQLDAQTFADWDVDYVKLDGCYANISDMAVGYPEFG
RLLNATGRPMVYSCSWPAYQEDAGEMPDYTSLKQHCNLWRNWDDIDDSLESVAQIMDYFG
KNQDRIQPHAGPGHWNDPDMLLLGNYGLSYDQSKLQMAIWSVMAAPLIMSNDLAVVRPEI
KDILQNRKVIAVDQDELGIQGRRILSKNQIEVWSRPITPVVSNNQHSYAVAFVSRRADGA
PYRIVFTLKELELHNTAGYDVQDLYDDKNHLGVFRPANQFITRVNPNGVTFYKFTAL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacatagcgtcgagcgtcttttttgggacttttctccttctgctgctgctgcacggc
ggaatgggactcgacaatggactggcactcacgccaccaatgggctggatgtcctgggag
cgtttccgctgcctaacagattgtaagctgtatccaaacgagtgcataagtgaggagctg
ttccggcggcatgcggatttgctggtgtccgagggctatgccgatgctggctacgagtac
atcatcatcgatgactgctggctggagaaaaaccgcgacaacaagaccaagaaattagtt
gcagacaagaagcgattccccaacggactgaatcctcttgcagatcatatacacaatatt
ggactgaaattcggcttgtaccaggactacggcacgaacacctgcgctggttttcctgga
gtcataaagcacatgcaactggatgcccagacctttgccgactgggacgttgactatgtc
aagctggatggctgctatgccaacatcagcgatatggccgtgggatacccagagttcgga
cgtctgctcaacgcgactggccgcccgatggtctattcctgcagctggcccgcctaccag
gaggatgctggagaaatgcccgactatacgtccttgaagcagcactgcaacctgtggcgc
aactgggacgacatcgacgattcgctcgagtctgtggcacagattatggactactttggc
aagaaccaggataggatccaaccacatgctgggccaggccactggaacgatcccgatatg
ctactgctgggcaactacggactgagctacgatcaaagtaagctgcaaatggccatttgg
tccgttatggcagcgccgctgatcatgtccaacgatttggccgtggtgcgtccagaaatc
aaggatattctgcagaatcgtaaagtgattgctgtggatcaagatgagttgggcatccag
ggccgtcgtatcctgtcaaaaaatcagatcgaagtctggagcagacccatcacgccggtg
gtcagcaataaccagcactcttatgccgtggcctttgtcagccgacgcgctgatggtgct
ccctacagaatcgtattcacactcaaggagctcgaactacacaataccgcaggctacgat
gtacaggacctctacgatgacaaaaatcacttgggcgtcttccgcccagccaaccagttt
atcacgcgcgttaatccgaatggtgtaactttctataagtttacagcactctga

DBGET integrated database retrieval system