KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20789
Entry
Dpse_GA20789      CDS       T01032                                 

Name
(RefSeq) uncharacterized protein, isoform A
  KO
K07364  tyrosine-protein kinase Tec [EC:2.7.10.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA20789
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpo01001]
    Dpse_GA20789
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     Dpse_GA20789
Protein kinases [BR:dpo01001]
 Non-receptor tyrosine kinases
  TEC family
   Dpse_GA20789
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 PH_11 SH3_10 SH3_2 ABC1
Other DBs
NCBI-GeneID: 4817015
NCBI-ProteinID: XP_001356602
FlyBase: FBgn0080779
UniProt: Q29MM7 A0A6I8UJP7
Position
4
AA seq 798 aa
MMMSTKMQRNAHNHGSIKSSASLRSSSKSFQAKMDKMSERLYDVVKSGSMVKRAQNKKRF
TPVNYKHRWFELTKRTLCYFDVENVERRRERGRIQLKGVRLVEEATVNGEGGDPFAPDGY
PFQVGYCEISSSQKHQQQQTELQDRSGVEGQQQQQNGGRAVPQYTLYVIANSEKERNEWI
RAIRQVCEDSNTPKSYRYHPGLWSGKKWSCCKGLSRTTFGCRAAAHWREANNNPSNGSSP
AQNSTRSISPNSSTTNSQFSLQHNSSGSLSGVGVGNGNGVVVGGGGGGGGSIGLGVGGGG
GSCTPTSLQPQSSLTTFKQSPTLLNGNGTLLDANMPGGIPTPGTPNSKAKDNSHFVKLVV
ALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDTVGNVGYIPSNYVKPKALLGLERY
EWYVGDMSRQRAESLLKQGDKEGCFVVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARC
EYYLSEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELML
MEELGSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVC
SKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDL
AARNCLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWA
YGVLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERP
AFRVLMDQLALVAQTLTD
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgatgatgagcactaagatgcagaggaatgcccataaccatggcagcatcaagtcttca
gcctccctccgctccagcagcaaatcctttcaggccaaaatggacaaaatgtcggagcgg
ctgtacgatgttgtcaagagcggctccatggtgaagcgggcacaaaacaagaagcgtttt
acgccggtcaactataaacatcgttggtttgagcttaccaagcggacactctgctatttc
gatgtggagaatgtggagcggagacgcgaacgcggccgaatacagttgaagggcgtacgc
cttgtggaggaggcgaccgtcaacggagagggcggcgatccctttgcaccggatggttat
ccattccaagtgggctactgtgagatttcctcatcgcaaaagcaccagcagcagcagacg
gagttgcaagatcgatctggggtcgagggacagcagcagcagcagaacggtggacgagcc
gtgccgcagtacacactctacgtgatagccaacagcgaaaaggagcgcaacgagtggatc
cgtgccatacgacaagtttgcgaggacagcaatacccccaagtcatatcgatatcatccg
ggtctgtggtcgggcaaaaagtggagctgctgcaagggcctctcacgcaccacattcgga
tgccgagcggctgcccattggcgcgaggcgaacaataatccaagcaacggcagttctcca
gcccagaattcaacgcgcagcatcagtccgaacagttccacgaccaacagtcaattcagt
ttgcagcacaacagctccgggagcctctcgggcgtcggtgtgggcaacggcaacggcgtc
gtcgtcggcggcggaggaggaggcggtggcagcattggcctgggagtaggcggaggaggc
ggcagttgcacgcccacatcgctgcagccacagtcctcgctgacaactttcaagcaatcg
ccaactttactgaacggcaacggaactctattggatgccaatatgcctgggggtatacca
acgcctggaactccaaattccaaagccaaggacaattcacattttgtcaaattggtggtg
gccctgtatcccttcaaggccatcgaaggtggagatttatctctagaaaagaatgccgag
tacgaggtcattgatgattcacaagagcactggtggaaggtcaaggatactgtaggaaat
gtcggctatatacccagcaactatgtcaaacccaaggctctgttgggcctcgaacgctac
gaatggtatgtgggcgacatgtcacgacaacgcgccgaatctctattgaaacagggcgac
aaggaggggtgctttgtggtgcgcaagtcatcgaccaagggtctctacacactatcgctg
cataccaaagttccacaatcccatgtaaagcactatcacatcaaacagaatgcccgctgc
gagtattatctgagcgagaagcactgctgcgagaccataccggatttgatcaactatcat
cgccacaattctggtggcttggcctgccgcttgaagtcctcgccctgcgatcgtccagtg
ccaccgacagcgggactatcccacgacaaatgggagatccatccgatggagctgatgctc
atggaggagctgggatcgggacagtttggggtggtgcgacgtggcaaatggcgtggctcg
atagacaccgccgtcaagatgatgaaggagggcaccatgtccgaggatgatttcatcgaa
gaggccaaggtcatgaccaagctgcagcacccgaatttggtgcagctgtacggcgtctgc
tcgaagcatcgacccatctacattgtcaccgagtacatgaagcacggctcgctgttgaac
tacttgcggcggcacgagaagacgctcattggcaatatgggcctgctgctcgacatgtgc
atacaggtcagcaagggcatgacctatctggagcgccacaactacatccatcgcgatttg
gcggcgcgcaattgtctcgtgggctccgagaatgtcgtgaaagtggcagactttggcctg
gcccgctatgtgctcgatgaccagtacaccagctctggcggcaccaagtttcccatcaaa
tgggcaccgcccgaggtcctcaactacacgcgattctcgtcgaaaagtgatgtgtgggct
tatggtgttttaatgtgggagatattcacctgtggcaagatgccctatggccgtctaaag
aacactgaggttgtggagcgtgtgcaacgcggaattatcctagagaaaccaaagtcgtgt
gccaaggagatctatgatgtcatgaagttgtgctggtcacatggtcccgaagagcgtcct
gcgttccgtgtgctcatggatcagctggctcttgtggcccagacgctaaccgactaa

DBGET integrated database retrieval system