KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21019Help
Entry
Dpse_GA21019      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00230  Purine metabolism
dpo00240  Pyrimidine metabolism
dpo00983  Drug metabolism - other enzymes
dpo01100  Metabolic pathways
Module
dpo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
dpo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
dpo_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dpse_GA21019
   00240 Pyrimidine metabolism
    Dpse_GA21019
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dpse_GA21019
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpo04131]
    Dpse_GA21019
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Dpse_GA21019
Membrane trafficking [BR:dpo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Dpse_GA21019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK DUF1126
Motif
Other DBs
NCBI-GeneID: 4802803
NCBI-ProteinID: XP_001359648
FlyBase: FBgn0081008
Position
2
AA seq 387 aa AA seqDB search
MTGAAQAERRLAFVAEWYQAEAAIIRTFLVTYFVADEAVEVFDQRSKKTFLRRTKIPELT
QRDFFVGSKINVFGRQFDIVDYADESTRSNLAKYRKRGFVLLKNNMWHKHLGKFLKTLIN
NKININNGQMVQFTPKMVTQFLSGKPKNEVVSSVLMNELLAGPAISMELIGDNVVEIMIA
CVKYKGPDGVNDSSSVKLSSSLEELFEQEDVRYGIYCPATEEDVAIDLKFFFEDRLSIMK
ECLFKNSTLAIIKPHSIKDGLLGDIVDEILANGFNVTAMRMILMARINCEEFYEVYRGIL
PEYIPMVAQLASGVCMCLEIVSADPGKSSYGDFRTFCGPMDPEIAKLLRPHTLRAKFGKS
KVLNAIHCTDLPDDTNLELQYMFKILD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgcagcacaggcagagcggcgactggcctttgtggccgaatggtatcaggcc
gaggctgccatcatacgtactttcctggtgacctactttgtggccgacgaggcagtggaa
gtgtttgatcaacgcagcaagaagacctttctgcgtcgcaccaagattccggagctgacg
caacgcgacttctttgtgggctcgaagatcaatgttttcggccggcaattcgacattgtt
gactacgcggacgagtcgacccgcagcaacttggccaaatatcgcaaaagaggattcgtg
ctgcttaagaataatatgtggcacaagcatctaggcaagtttctgaagacactcatcaat
aacaagattaacatcaacaacggacagatggtacagttcactcccaaaatggtgacacag
ttcctctccgggaagcccaagaacgaagttgtatcctctgtcctgatgaacgaactattg
gccggcccggccatcagcatggagctgatcggcgacaacgtggtggagatcatgatcgct
tgtgtcaagtacaagggtccggatggggtcaatgactcctcctccgtgaagctgtcgtcc
agcctggaggagctgttcgagcaggaggatgtgcgctacggaatctactgtcctgcgacc
gaggaggatgtcgccatagacttgaagttctttttcgaagaccgcctcagcatcatgaaa
gaatgtctattcaagaactctacgctggccatcatcaagccgcacagcataaaggacggc
cttttgggtgacatcgttgacgaaattctggccaacggcttcaatgtgactgccatgcgc
atgattctaatggcgcgaatcaattgcgaggagttttacgaggtctatcgcggtatcctt
cccgagtatatacccatggtagcgcagctagccagcggcgtgtgcatgtgccttgagatc
gtctctgccgatccgggaaagagtagctacggcgacttccgtacattctgcggtcctatg
gacccggaaatagccaagctattgcgcccccacaccctccgcgccaagtttggcaagtcc
aaggtgctcaatgcaattcactgcacagatctgccagatgataccaatctggagctgcag
tacatgttcaagatcctcgactga

DBGET integrated database retrieval system