KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21120
Entry
Dpse_GA21120      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08762  diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB
Motif
Pfam: ACBP
Other DBs
NCBI-GeneID: 4817139
NCBI-ProteinID: XP_001356518
FlyBase: FBgn0081108
UniProt: Q29MW1
Position
4
AA seq 90 aa
MAELQEFNQAAEDVKNLNTTPADNDLLELYSLFKQATVGDCNTDKPGFLDFKGKAKWEAW
NARKGMSNADAQGAYIAKVKGLISSVGLKS
NT seq 273 nt   +upstreamnt  +downstreamnt
atggccgaattacaggaattcaatcaagctgccgaagatgttaagaatctgaataccacg
ccggcagataatgaccttttggaactctacagcctgttcaagcaggccacagtgggcgat
tgcaataccgacaagcccggtttcttggactttaagggcaaggcgaagtgggaggcctgg
aatgcacgcaaaggaatgagtaatgccgatgcgcagggcgcgtatatagccaaagttaag
ggattgatttcctccgtaggactaaagtcttaa

DBGET integrated database retrieval system