KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21309Help
Entry
Dpse_GA21309      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00220  Arginine biosynthesis
dpo00250  Alanine, aspartate and glutamate metabolism
dpo00471  D-Glutamine and D-glutamate metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dpse_GA21309
   00220 Arginine biosynthesis
    Dpse_GA21309
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dpse_GA21309
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Dpse_GA21309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_4 Ank_2 Ank Ank_5 Ank_3
Motif
Other DBs
NCBI-GeneID: 4804764
NCBI-ProteinID: XP_001361275
FlyBase: FBgn0081297
UniProt: Q28YW2
Position
3
AA seq 719 aa AA seqDB search
MFKGVPALASQNLRFLRSHTEQAATAGLGLGLAKRSKASSVELAAAEPTDVHSPGESNLL
NRVKFGHTGQQVKQKITTEKKLRAPPLMNLVFANRKLSFYDTSSGRNEENAKLNQRRHYS
MRPHREQEQRNAEDVLFDMFASEETGLISMGKFLNGLKTTGIRRNDPRVRELMDNLKKVH
KLNNYETGSSAETQHLNRETFKAVVAPNIVLIAKAFRQQFIIPDFSSFVKDIEEIYCRCK
TNTLGKIADYIPQLTRYCPESWGVSICTVDGQRFSIGDVEEPFTLQSCSKPLTYAIALEK
LGPKVVHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIF
DYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDYYF
QCCAMETNCEAMSVIAASMANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFK
VGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDDLGNTVRGVQFCEELVNMFNFHRYDNLKH
LSNKKDPRKHRYETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLASS
EGHLECVKFLLEQCHVPHNPKDRWGNLPVDEAENFGHSDVVEYLKSWAEKTVAAPECTPE
AVTTKTEADEELCSTSDLDRSPNSSPIPTESGSGHSSPAPSEAGSTVSIASDDKTKPGL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaggtgttcccgctctagcaagccagaatcttcgcttcctgaggagccacacg
gagcaggcagccaccgctggcctgggcctgggcctggcgaaacgctcaaaggcatcgtct
gtggaactggccgcggcagaaccgactgatgtccactctcctggggagtcgaacctgctg
aatcgcgtcaagtttggccatacgggccagcaagtgaagcagaaaataactactgagaag
aaactgcgcgctccgccgcttatgaatctggtgtttgccaaccgcaagctatccttctac
gacaccagctccggacgcaacgaggagaatgcgaaactcaatcagcgacgccactattcg
atgcggccccaccgggagcaggagcagcgcaatgccgaggatgtgctgttcgatatgttt
gccagcgaggagaccggcctgatctcgatgggcaagttcctgaacggactgaagaccacc
ggcatcaggcggaatgatccacgggtgcgcgagctgatggacaacctaaagaaggtacac
aagctgaacaactacgagacgggatcctcggccgagacgcagcacctcaaccgggagacc
tttaaggccgtggtggctcccaatatcgtactaattgcgaaggcattccgacagcaattc
atcatccccgacttctcgagcttcgtcaaggacatcgaggagatctactgtcgctgcaag
accaacaccctgggcaaaatcgccgactacattccgcagctgactcgctactgtcccgaa
tcgtggggcgtgagcatctgcaccgtcgacggacagcgcttctccatcggcgatgtggag
gaaccgttcacattgcaaagttgcagtaaaccgcttacctatgccatcgccctggagaag
ctcggtccaaaggtggtgcactcttacgtgggacaggagcccagcggcaggaacttcaat
gagctggtcctggaccagaacaagaagccacacaatcccatgatcaatgccggtgccatc
cttacctgctccctgatgaacgcactggtcaagcctgacatgacctcggccgagatcttc
gactacaccatgtcctggttcaagcgcttgtccggcggagagtacatcggctttaacaat
gccgtgttcctctcggagcgagaggctgctgaccgcaactatgccctcggcttctatatg
cgggagaacaagtgcttccccaagcggaccaacctgaaggaggtgatggactactatttc
cagtgctgcgccatggagaccaactgcgaggcgatgtccgtgattgcagccagcatggcc
aacggcggcatctgccccaccaccgaggagaaggttttccggccagaggtcatccgcgat
gtgctctcgatcatgcactcctgcggcacgtacgactactcgggccagtttgccttcaag
gtgggcctgccggccaagtctggcgtcagcggtggcatgatgctggtcatccccaacgta
atgggcatcttcgcctggtcgccgccactcgacgacttgggaaacacagtgcggggcgtg
cagttctgcgaggagctggtcaacatgttcaacttccatcgctacgacaacctgaagcat
ctgtccaacaagaaggatccgcgcaagcaccgctacgagaccaagggcctgtccattgtc
aacctactcttttcggcggccagcggcgatgtaacggctctgcgccggcaccgactgtcc
ggcatggacatcaccctggcagactacgacggacgcaccgccctgcacttggcctcctca
gagggccacctggagtgcgtcaagttcctgctggagcagtgccatgtgccgcacaacccc
aaggatcggtggggcaacctgcccgtcgatgaggctgagaactttggccactcggacgtg
gtagagtacctcaagtcctgggccgagaagaccgttgcagccccagagtgcacaccggag
gcggtgaccacgaaaaccgaggcggatgaggaactgtgcagcaccagcgatctcgatcgc
agtcccaactccagccccattcccactgagtctggatcgggacactccagcccggcgccc
tcggaggcgggaagtacagtaagcatcgccagcgatgacaagaccaagccgggtctctag

DBGET integrated database retrieval system