KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21310
Entry
Dpse_GA21310      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpo01002]
    Dpse_GA21310
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpo04147]
    Dpse_GA21310
   04090 CD molecules [BR:dpo04090]
    Dpse_GA21310
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     Dpse_GA21310
Peptidases and inhibitors [BR:dpo01002]
 Metallo peptidases
  Family M1
   Dpse_GA21310
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA21310
CD molecules [BR:dpo04090]
 Proteins
  Dpse_GA21310
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Sulf_coat_C
Other DBs
NCBI-GeneID: 4801278
NCBI-ProteinID: XP_001358398
FlyBase: FBgn0081298
UniProt: A0A6I8UNK6
Position
2:complement(9983640..9987201)
AA seq 982 aa
MIITAKLVAIGLSLALTAFTVSTIVLAVQKSSLKSDLREAQEKLDMLEAGLQTTSTSTVA
PPSTGTPSETDPSSPTSAPETTADPITTAAPITTAAPITTAAPEEKIDYRLPSRLEPTHY
DLYLFPNVETGEFNGQETITLTVHEATDTIVLHSLDLNISSVSVLKPDYSSVEVSEISFD
AVREFLVLQLAEELSAGINVDLHLGFAGSMANKIVGLYSSSYVKEDESRKVIATSKFEPT
YARQAFPCFDEPALKATFQITLVHPVDGDYHALSNMNVESEVNQGAYTEVTFSKSVPMST
YLACFIVSDFTAKFVEVDTKGIGETFTMGVYATPEQIGKVDFATEVGKGVIEYYIDYFQI
EYPLPKLDMAAIPDFVSGAMEHWGLVTYRETSLLYDAETSSATNKQRIASVIAHEFAHMW
FGNLVTMNWWNDLWLNEGFASFIEYLGVDSVFPEWKMRDQFIYSTLHAVLTLDGTLGSHP
IIQTVENPDQITEIFDTITYSKGSSLVRMVEDFLGETIFRQAVTNYLNEYKYTTAETSNF
FAEIDKLGLDYNVTAIMLTWTVQMGLPVVTVEKISETEYKLTQKRFLSNPNDYDADHEPS
EFNYRWSIPITYTTSGESTVQRVWFYHDQSEITITLPAAVQWIKFNSEQVGYYRVNYAEA
LWESLATELVATPSTFSSGDRASLLNDAFALADSTQLPYETAFDMTKYLDKEEDYVPWSV
AASKLTSLKRTLYYTTSYVKYKKYATALIEPIYTALTWTVGEDHLDNRLRVTALSAACSL
GLESCLSEVGEQFNSWLVKPDERPKPDLRETIYYYGMQSVGNQEIWEKVWELFVNEADAS
EKSKLMYGLAAVQEPWILQRYIDLAWNEEYVRGQDYFTCLTYIAANPVGESLVWEYVREN
WQKLVVRFGLNERYLGNLIPSITARFSTQTKLEEMEYFFEKYPEAGAGTAARVRALETVK
NNIVWLAENLEAVDAWLDNQQL
NT seq 2949 nt   +upstreamnt  +downstreamnt
atgattatcacagcgaaattggtggccatcggcctgagcctcgccctcaccgccttcacc
gtctccaccattgtcctggctgtgcaaaagtccagtttgaagagcgatctccgagaggcc
caggaaaaacttgatatgctggaagcgggcctgcaaacaacgtcaaccagcacggtggct
cctccgagcacaggaacaccttcagaaactgacccatcgagccctacctcagcccctgaa
accacagcagatccgatcaccaccgcagctccgatcaccaccgcagctccgatcactacc
gcagctccggaagagaagattgactatcgcctccccagccgcttggagcccacccactac
gatctttatctgttccccaatgtggagaccggagagtttaatgggcaggaaacgattacc
cttaccgtccacgaggcaaccgataccattgtcctgcactccctggatctgaacatttcg
agcgtgtctgtccttaagcccgactattcgagcgtggaagtctcggagatcagcttcgac
gcggttagggagtttctggttctgcagctggcagaagagctgagcgcgggcatcaacgtg
gacctacatctaggattcgcgggatccatggccaacaagattgtgggactgtacagttcg
tcgtatgttaaggaggatgagagccgcaaggtgatagcgacgtccaagttcgagcccacc
tatgcccgccaggccttcccctgcttcgatgagccggccctgaaggccaccttccagata
accctcgtgcaccccgtcgatggcgactaccatgccctgtccaacatgaacgtggagtcc
gaagtcaatcagggggcctacaccgaagtaaccttctccaagagcgtgcccatgagcacc
tatctggcctgtttcattgtctctgacttcaccgcaaaattcgttgaggtggataccaaa
ggcattggcgagacttttacaatgggcgtttacgccacccccgagcagatcggaaaggtc
gattttgccacggaagtgggcaagggtgtaattgagtactacattgactacttccaaatc
gagtatcccctgcccaagctcgacatggccgccattcccgacttcgtgtccggtgccatg
gagcactggggcctggtcacctaccgcgagacttcccttctatacgatgccgagacgagt
tctgcgaccaacaagcagcgcattgcctccgtcattgcccacgagttcgctcacatgtgg
tttggaaatttggtgaccatgaattggtggaacgatctctggctgaacgagggctttgcc
agcttcatcgagtaccttggcgtggattcagtcttccccgaatggaaaatgcgggaccag
ttcatttatagcacattgcatgcggttctgaccttggacggaactttgggctcccatcca
atcatccagaccgtggaaaaccccgaccaaatcacggaaatcttcgacaccatcacctac
tccaagggatcctctctggtgcgcatggtggaggactttctgggcgagaccatcttccgc
caggccgtgaccaactatctaaatgagtacaagtacacaaccgccgagacgtccaatttc
ttcgccgagatcgataagctgggtctggactacaatgtgaccgccatcatgttgacgtgg
acagtccagatgggtctgccagttgtcacggtggagaagatctccgaaactgaatacaaa
ttgactcagaagcgcttcttgtcgaatcccaacgactatgacgctgatcacgagccctcg
gaattcaactaccgctggtcaatacccatcacatacaccaccagcggcgagtcgactgtg
cagcgggtctggttttaccatgaccagagcgaaatcaccattactctgccagctgctgtg
cagtggatcaaattcaactctgagcaagtgggctactaccgagtaaactatgctgaggcg
ctgtgggagtcgttggccacagagcttgtggccacgcccagtacctttagttccggagat
cgcgcctccctgctgaacgacgccttcgcccttgcggactccacgcagctgccgtacgag
accgctttcgacatgaccaagtatctggacaaggaggaggactatgtgccctggagcgtt
gccgcctcgaagctgacatctcttaagcgtacactctactacacgaccagctacgtgaag
tacaagaagtatgcgacggctctgatcgaacccatctacacggccctcacctggacagtg
ggagaggatcacctggacaatcgtcttcgtgtgacagccctgagtgccgcctgttccctg
ggcctggaatcttgtctcagcgaggtgggagagcagttcaacagttggctggttaagccc
gatgagcgccccaagccagatctccgcgagaccatctactactacggcatgcaatcggtg
ggaaaccaagagatctgggagaaggtctgggagctgtttgtcaacgaggccgatgccagc
gagaaatcgaagctgatgtatggcctggccgctgtgcaggagccctggatcctgcagcgc
tacattgacctggcctggaacgaggagtacgtgcgaggtcaggactacttcacctgtctg
acttacattgcggccaatcccgtgggcgagtccctggtctgggagtatgtgcgcgagaac
tggcagaagttggtggttcgctttgggctgaacgagcggtatctgggcaaccttataccg
tcgatcacggctcgcttcagcactcagacgaagctcgaggaaatggagtacttcttcgag
aagtatcccgaagcaggagccggaactgcggcacgcgtgcgcgccctggagacggtgaag
aacaacattgtctggttggccgaaaatctcgaagccgtcgacgcctggctggacaatcag
caactgtag

DBGET integrated database retrieval system